SecReT6
Protein ID: 76818313
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0533
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]720429..720923 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ3JL60
KEGG IDbpm:BURPS1710b_A0533
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.30E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|76818313|ref|YP_335693.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKDDFNDVMRAQN
LQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRR
RIQEIVADKGARKQLLDELGLDEQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|76817237|ref|NC_007435.1|:720429-720923 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGACAACGAACGGATCCGTCGCGCCCAAAGAGCGGGTCAACATCGTCTATCGCCCGGCGACGGGCGACG
CACAGGCGGAGGTCGAGCTGCCGCTCAAGGTGCTCGTGCTCGGCGAGTTCTCGACGGCCGCCGACAAGCC
GCCGCTCGAGGAGCTCTCGCCCGTGAACGTCGACAAGGACGACTTCAACGACGTGATGAGGGCGCAGAAC
CTCCAGCTCGCGCTCAGCGTGCCGAACCTGCTGGACGATCAGGCCGGCGAGGACGACCGGCTGTCCGTCA
CGCTCGGCTTCGATTCGGTGCACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTCAAGCA
GCTGATCGCGCTGCGCGACGCGCTGAAAGCGCTGAAGAGCCCGATCGGCAACATTCCCGGCTTTCGCAGG
CGCATCCAGGAGATCGTCGCCGACAAGGGCGCGCGCAAGCAGTTGCTCGACGAACTCGGCCTCGACGAAC
AATGA