SecReT6
Protein ID: 76818318
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1691
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2065315..2066661 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ3JHV5
KEGG IDbpm:BURPS1710b_A1691
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.70E-144, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|76818318|ref|YP_336848.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGFSHFSLDSEAPALGKIIVKSASGVFA
DGTPFDAPGSTPPPAPLTIRPEHLDQVIYLAVPIRVPNGEETAFDRAAESLARYAVFETDLRDTNSIGQG
PKTVQLSNLRLRLLPEKELTDAWIGLALTRVKTIRADASIELDDMLIPPVVGYGASDTLASWLAKIHDLT
RLRANALAERLTGSDGRAGTTAEVSDYLLLQTLNRYEPMLKHLQRVPTTSPAELYALLIGMAGELSTYVR
TDTRRPLDTHPPYQHVAPHLCLKPVVDDTHRLLNAVLVRSAQRLALADLGHGMLNAVVDPVDMQGFTAVV
LAVHAQMPPDLLQQQFAAQAKAGPSERLPDLVRSHLSGIALQALPVPPRQIPFNAGYVYYELARGGPLWD
EVARHGGLALHIAGEFPSLKLELWGIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c2066661-2065315 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGAGCTGGCATAACAAGGTCGTCTGGAGCGAGGGGCTTTTCATGCGCCCGCAGCTGTTCCAGCAGCAGG
AGCGCTATCTCGAGCACTACGCGCACAAGCGCGCGGCGCCGCTGTCGCCGTTCTTCTTCGGCTTCAGCCA
CTTCAGCCTCGACAGCGAGGCGCCGGCGCTCGGCAAGATCATCGTGAAATCGGCGAGCGGCGTGTTCGCC
GACGGCACGCCGTTCGACGCGCCGGGCAGCACGCCGCCGCCCGCGCCGCTCACGATCCGGCCCGAGCATC
TGGACCAGGTGATCTACCTCGCGGTGCCGATCCGCGTGCCGAACGGCGAGGAAACCGCATTCGACCGCGC
GGCCGAATCGCTCGCGCGCTATGCCGTGTTCGAAACCGACCTGCGCGACACGAACTCGATCGGGCAAGGG
CCGAAGACGGTCCAGTTGTCGAACCTGCGCCTGCGGCTGCTTCCGGAAAAGGAACTGACGGACGCGTGGA
TCGGGCTCGCGCTCACGCGCGTGAAGACGATTCGCGCGGACGCGAGCATCGAGCTCGACGACATGCTGAT
TCCGCCCGTGGTCGGCTACGGCGCGAGCGACACGCTCGCGAGCTGGCTCGCGAAGATCCACGATCTCACG
CGCCTGCGCGCGAACGCGCTCGCCGAGCGCCTGACGGGCTCGGACGGCCGGGCGGGCACGACGGCCGAAG
TATCCGACTACCTGCTGCTGCAAACGCTCAATCGCTACGAGCCGATGCTGAAACACCTGCAGCGCGTGCC
CACGACGTCGCCCGCCGAGCTGTACGCGCTGCTCATCGGCATGGCGGGCGAGCTGTCCACCTACGTGCGC
ACCGATACGCGCCGGCCGCTCGATACGCACCCGCCCTATCAGCACGTCGCGCCGCATCTGTGCCTGAAGC
CCGTCGTCGACGACACGCACCGGCTGCTCAACGCCGTGCTCGTGCGCAGCGCGCAGCGCCTCGCGCTCGC
CGATCTGGGGCACGGAATGCTCAACGCGGTCGTCGATCCGGTCGACATGCAGGGCTTCACCGCGGTCGTG
CTCGCGGTGCATGCGCAGATGCCGCCCGATCTGCTGCAGCAGCAGTTCGCCGCGCAGGCGAAGGCGGGGC
CGTCCGAGCGGCTGCCGGACCTCGTGCGCAGCCATCTGTCCGGCATCGCGCTGCAGGCGCTGCCGGTGCC
GCCCCGGCAGATCCCGTTCAACGCCGGCTACGTCTATTACGAGCTCGCGCGCGGCGGGCCGCTGTGGGAC
GAAGTCGCGCGGCACGGCGGGCTCGCGCTGCACATCGCCGGCGAATTTCCGTCGCTGAAGCTCGAGCTAT
GGGGCATTCGCGGATAG