SecReT6
Protein ID: 76818412
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0530
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]715726..717609 [-]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDQ3JL64
KEGG IDbpm:BURPS1710b_A0530
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 67..126
ImpA-rel_N [PF06812], Evalue: 2.80E-18, Aligned region: 587..597
Protein Sequence: 627 a.a.     [Download]
>gi|76818412|ref|YP_335689.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MSERRPPGGAAARARMPIDVEALAVLGRTDIDSAMPAGADVRADARFDALHAELAKLASPGASGQVDWRA
ATHLAAELLRERGKDLLVGCYLAGALLQTGGAAGLRCGLEIVGDLVERHWDAMSPPVSRMRARRGALQWL
VDRVDAMHDAGAAACGGACSAELVAQLRAAARRIDALLAERDDDAPTMRAVHAFAERLPVEVVEVVEVAD
EADVAEATEATEATEATEAADVADVAETAETAETAETAEADAHGSTGGPAAEIAIAAAEQALIDPAGRAA
PSAGTDTNANADAAGQPARLDEAAGRERALADALAQLHCVATAFAQADWADARGFRLRRVACWSSVCALP
ETDAENGRTRIAAPSASIVGAAKSIDGDGEPVAAVRFAEAHAQAFPLWLDLQRIAARALARAGGDGADAR
REVETAVRALLARLPGLDALTFADGTPFADDATRAWLGELGAPVVAADAVSPSSLPLSPRPSPPERSSPM
AGEPARAPGDACGASADDAVDRACAFAASGQLDLALHAIQHAIDRATSAEQRLRARVRLCELARDHWPHE
VPEAFARGVIEPIRRHDLLAWNPELALDGLSAAYALLIRRDRESAHARTVLDEIASVDAARAMRLST
 
Nucleotide Sequence: 1884 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c717609-715726 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGAGCGAACGGCGCCCGCCCGGCGGCGCGGCGGCGCGCGCGCGCATGCCGATCGATGTCGAAGCGCTCG
CCGTGCTGGGGCGCACGGACATCGATTCCGCCATGCCCGCGGGCGCCGACGTGCGCGCCGACGCGAGGTT
CGACGCGCTGCACGCGGAGCTTGCGAAGCTCGCGTCGCCGGGCGCGAGCGGGCAAGTCGATTGGCGCGCG
GCGACGCATCTCGCCGCCGAATTGCTGCGCGAGCGCGGCAAGGATTTGCTCGTCGGCTGCTATCTGGCGG
GTGCGTTGCTGCAGACGGGCGGCGCGGCGGGGCTGCGCTGCGGACTCGAAATCGTCGGCGATCTCGTCGA
ACGTCATTGGGATGCGATGTCGCCGCCCGTGTCGCGGATGCGGGCGAGGCGCGGGGCGCTGCAATGGCTG
GTCGATCGCGTCGACGCCATGCACGATGCAGGAGCCGCCGCATGCGGCGGCGCGTGCTCGGCCGAACTGG
TCGCGCAATTGCGCGCGGCCGCGCGGCGCATCGATGCGCTGCTCGCCGAGCGCGACGACGACGCGCCGAC
GATGCGCGCGGTGCATGCGTTCGCGGAGCGATTGCCGGTTGAGGTGGTTGAGGTGGTGGAAGTGGCTGAC
GAGGCTGATGTGGCTGAGGCGACTGAGGCGACTGAGGCGACTGAGGCGACTGAGGCGGCTGATGTGGCTG
ATGTGGCTGAGACGGCTGAGACGGCCGAGACGGCCGAGACGGCCGAGGCCGATGCGCACGGCTCGACGGG
AGGGCCGGCTGCGGAAATCGCGATTGCCGCCGCCGAACAGGCTTTGATTGATCCGGCCGGTCGAGCCGCG
CCGAGCGCAGGCACGGATACGAACGCGAACGCAGACGCCGCCGGGCAACCGGCGCGGCTCGACGAAGCGG
CCGGCCGCGAACGCGCGCTCGCCGATGCGCTCGCGCAACTGCATTGCGTCGCGACGGCGTTCGCGCAAGC
GGACTGGGCCGACGCGCGCGGCTTCCGGCTGCGCCGCGTCGCGTGCTGGTCGAGCGTGTGCGCGCTGCCG
GAAACGGACGCGGAGAACGGAAGAACGCGGATCGCCGCGCCGAGCGCTTCGATCGTCGGCGCGGCGAAGA
GCATCGACGGGGATGGCGAGCCCGTGGCGGCGGTGCGCTTCGCCGAAGCGCATGCGCAGGCGTTCCCGCT
CTGGCTGGATTTGCAGCGCATCGCCGCGCGCGCGCTCGCGCGCGCGGGGGGCGACGGCGCCGATGCGCGG
CGCGAAGTGGAGACGGCGGTTCGTGCGCTGCTTGCGCGGCTGCCGGGCCTCGACGCGCTGACGTTCGCGG
ACGGCACGCCGTTCGCCGACGACGCGACGCGCGCATGGCTCGGCGAGCTTGGCGCGCCTGTTGTGGCGGC
GGATGCGGTGTCGCCGTCGTCTTTGCCGCTTTCGCCGCGACCTTCGCCGCCTGAGCGATCGTCGCCGATG
GCGGGCGAACCGGCGCGCGCGCCGGGCGATGCGTGCGGGGCGAGCGCCGACGATGCAGTGGACCGAGCGT
GCGCGTTTGCCGCGAGCGGCCAGCTCGATCTCGCGCTCCACGCGATTCAGCATGCGATCGATCGTGCGAC
GAGCGCCGAACAGCGGTTGAGAGCACGCGTGCGGTTGTGCGAGCTTGCGCGCGACCATTGGCCGCATGAG
GTTCCTGAGGCGTTCGCGCGCGGCGTGATCGAACCGATTCGGCGGCACGATTTGCTCGCATGGAATCCGG
AGCTGGCGCTCGACGGCTTGTCGGCCGCCTATGCGCTGCTGATTCGGCGCGATCGCGAATCGGCGCACGC
GAGGACGGTGCTTGACGAGATCGCGAGCGTCGACGCGGCGCGGGCCATGCGTTTGTCGACGTGA