SecReT6
Protein ID: 76818455
SecReT6 ID94
T6SS typei3
Gene symbolsciG
Locus tagBURPS1710b_A1625
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1982538..1985294 [+]
ProductSciG protein
NoteTssH
UniProt IDQ3JI21
KEGG IDbpm:BURPS1710b_A1625
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 9.60E-39, Aligned region: 267..347
AAA_2 [PF07724], Evalue: 9.60E-39, Aligned region: 645..810
AAA [PF00004], Evalue: 9.30E-21, Aligned region: 269..400
AAA [PF00004], Evalue: 9.30E-21, Aligned region: 650..734
ClpB_D2-small [PF10431], Evalue: 3.40E-15, Aligned region: 477..494
ClpB_D2-small [PF10431], Evalue: 3.40E-15, Aligned region: 817..890
AAA_5 [PF07728], Evalue: 5.40E-15, Aligned region: 269..347
AAA_5 [PF07728], Evalue: 5.40E-15, Aligned region: 649..768
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 246..290
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 310..347
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 414..435
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 620..692
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 714..733
AAA_16 [PF13191], Evalue: 3.30E-09, Aligned region: 812..849
Sigma54_activat [PF00158], Evalue: 3.60E-09, Aligned region: 265..349
Sigma54_activat [PF00158], Evalue: 3.60E-09, Aligned region: 649..748
AAA_22 [PF13401], Evalue: 6.90E-08, Aligned region: 269..350
AAA_22 [PF13401], Evalue: 6.90E-08, Aligned region: 648..672
AAA_22 [PF13401], Evalue: 6.90E-08, Aligned region: 711..736
AAA_19 [PF13245], Evalue: 1.90E-07, Aligned region: 267..295
AAA_19 [PF13245], Evalue: 1.90E-07, Aligned region: 647..671
AAA_17 [PF13207], Evalue: 9.20E-06, Aligned region: 269..308
AAA_17 [PF13207], Evalue: 9.20E-06, Aligned region: 649..687
AAA_18 [PF13238], Evalue: 1.70E-05, Aligned region: 269..330
AAA_18 [PF13238], Evalue: 1.70E-05, Aligned region: 650..681
Zeta_toxin [PF06414], Evalue: 2.80E-05, Aligned region: 269..291
Zeta_toxin [PF06414], Evalue: 2.80E-05, Aligned region: 642..689
AAA_29 [PF13555], Evalue: 3.50E-05, Aligned region: 261..288
AAA_29 [PF13555], Evalue: 3.50E-05, Aligned region: 647..674
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 269..297
NACHT [PF05729], Evalue: 6.40E-05, Aligned region: 649..676
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 269..293
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 473..522
AAA_25 [PF13481], Evalue: 0.00013, Aligned region: 647..675
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 260..289
IstB_IS21 [PF01695], Evalue: 0.00016, Aligned region: 649..669
AAA_14 [PF13173], Evalue: 0.00027, Aligned region: 269..349
AAA_14 [PF13173], Evalue: 0.00027, Aligned region: 648..736
DEAD [PF00270], Evalue: 0.0029, Aligned region: 257..282
DEAD [PF00270], Evalue: 0.0029, Aligned region: 341..353
DEAD [PF00270], Evalue: 0.0029, Aligned region: 413..438
DEAD [PF00270], Evalue: 0.0029, Aligned region: 649..831
TIP49 [PF06068], Evalue: 0.0033, Aligned region: 269..295
TIP49 [PF06068], Evalue: 0.0033, Aligned region: 329..349
TIP49 [PF06068], Evalue: 0.0033, Aligned region: 648..684
RNA_helicase [PF00910], Evalue: 0.0041, Aligned region: 270..290
RNA_helicase [PF00910], Evalue: 0.0041, Aligned region: 650..671
T2SE [PF00437], Evalue: 0.0068, Aligned region: 259..289
T2SE [PF00437], Evalue: 0.0068, Aligned region: 645..718
NTPase_1 [PF03266], Evalue: 0.0098, Aligned region: 269..291
NTPase_1 [PF03266], Evalue: 0.0098, Aligned region: 649..671
RuvB_N [PF05496], Evalue: 0.0098, Aligned region: 267..288
RuvB_N [PF05496], Evalue: 0.0098, Aligned region: 340..349
RuvB_N [PF05496], Evalue: 0.0098, Aligned region: 611..670
RuvB_N [PF05496], Evalue: 0.0098, Aligned region: 718..742
Protein Sequence: 918 a.a.     [Download]
>gi|76818455|ref|YP_336782.1| sciG gene product [Burkholderia pseudomallei 1710b]
MSCLSRRARLHETKPDRGRDFPVLCANVAYSRIHDRDMTVSRQALFGKLGYSLFRSIESATAFCKLRGNP
YVELVHWLHQMLQAADGDMQRIARHCDIDLGELERDMVRALGELPAGASSISDFSHHIETAIERAWVLAT
LDFGDRRIRGAWLLAALLKTPELRRVLLSISSAFGRIRVDELDAMLPAWIDGSPEANETPYDNSDFGAAI
PGEASSAMQQKGGGSPLEQFCLDLTARARAGQIDPVVGRELEIRTMIDVLLRRRQNNPLLTGEAGVGKTA
VVEGLARAIAAGDVPPKLADARLLSLDVGALLAGASMKGEFEARLKGVLEAAAKATLPVILFVDEIHTLI
GAGGQAGTGDAANLLKPALARGTLRTIGATTWAEYKRHIEKDPALTRRFQVLQVPEPDEAAAIDMVRGLT
RTFSRHHGVVVLDEAIRAAVKLSHRYIPSRQLPDKAISLLDTACARVALSQHAPPRELQDVRRRLEAARV
RLELLDGEQRIGLGDEAALAQSRAEIAALEVEEQSIDACWRQQIEAAQTLLSAREAAGDAAASAIDALRE
LEHALSNLQGDHAFVFPEVNEAIVAEIMSDWTGIPVGRMVTDEVSAVRALPDTLAARVIGQRDALHQIGD
RVQTARAGLTDPKKPLGVFLLAGPSGVGKTETALALAEALYGGEQNLITINMSEYQEAHTVSGLKGAPPG
YVGYGEGGVLTEAVRRRPYSVVLLDEIEKAHPDVHEMFFQVFDKGYMEDGDGRYIDFRNTTILLTSNAGS
DLVSGLCMDEACAPDADGLCAALASELLKTFPAAFLGRVTLVPYRPLAQETLSRIVRLHLDRVVTRMAEN
QAVALRYSDNVVDYVVNRCLVQETGARLLIGFIEQHVLPLLAKLWLDSLASKHVLTRVDLDVADPAAAPT
EAFALRAS
 
Nucleotide Sequence: 2757 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1982538-1985294 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGTCGTGCCTTTCCAGGCGAGCGCGCTTGCACGAGACGAAACCGGATAGGGGGCGCGATTTTCCGGTTT
TGTGTGCAAACGTCGCATATTCACGAATTCACGATCGAGACATGACAGTTTCAAGACAGGCACTATTCGG
CAAGCTCGGCTACTCGCTGTTTCGCAGCATCGAATCGGCGACGGCGTTCTGCAAGCTTCGCGGCAACCCT
TACGTCGAGCTGGTGCATTGGCTGCATCAGATGCTTCAGGCCGCTGACGGCGATATGCAGCGGATCGCTC
GCCACTGCGACATCGACCTCGGCGAGCTGGAGCGCGACATGGTGCGCGCGCTCGGCGAACTGCCGGCGGG
CGCGAGTTCGATCAGCGATTTCTCGCACCACATCGAGACGGCGATCGAGCGCGCGTGGGTGCTGGCGACA
CTGGACTTCGGCGATCGCCGGATTCGCGGCGCGTGGCTACTGGCTGCGTTGCTGAAGACGCCGGAGCTCA
GGCGCGTACTGCTGTCGATTTCGTCCGCGTTCGGCCGGATTCGTGTCGACGAACTGGATGCGATGTTGCC
GGCCTGGATCGACGGCTCGCCCGAGGCGAACGAGACGCCGTACGACAACAGCGACTTCGGCGCGGCCATA
CCGGGCGAGGCGTCGAGCGCGATGCAGCAAAAGGGCGGCGGTTCACCGCTGGAGCAGTTCTGCCTCGATC
TCACCGCGCGAGCGCGAGCGGGGCAGATCGATCCGGTCGTCGGTCGTGAGCTGGAAATCCGCACGATGAT
CGACGTCCTGTTGCGCCGCCGCCAGAACAACCCGCTGCTGACGGGCGAGGCGGGCGTGGGCAAGACGGCC
GTCGTCGAAGGGCTCGCGCGCGCGATCGCCGCCGGCGATGTGCCGCCGAAGCTTGCCGATGCGCGCCTGC
TGAGCCTCGATGTCGGCGCGCTGTTGGCCGGGGCGAGCATGAAGGGCGAATTCGAGGCGCGCCTGAAAGG
CGTGCTGGAGGCGGCGGCGAAAGCGACGCTGCCCGTCATTCTGTTTGTCGACGAGATTCACACGCTGATC
GGCGCGGGCGGCCAGGCGGGCACCGGAGATGCCGCGAACCTGCTCAAGCCCGCGCTCGCGCGCGGCACGC
TGCGAACGATCGGTGCGACGACGTGGGCGGAATACAAGCGGCACATCGAAAAGGATCCGGCGCTCACACG
CCGCTTCCAGGTGTTGCAGGTTCCCGAGCCCGACGAGGCGGCCGCGATCGACATGGTTCGAGGGCTGACG
CGAACCTTCTCGCGTCATCATGGCGTCGTCGTGCTGGACGAGGCGATTCGCGCGGCGGTCAAGCTGTCGC
ATCGCTACATTCCATCCCGTCAGTTGCCGGACAAGGCGATCAGCCTGCTCGATACGGCGTGCGCGCGCGT
CGCGTTGTCGCAGCATGCGCCGCCGCGTGAGCTGCAGGACGTCCGCAGAAGATTGGAGGCCGCGAGGGTG
CGGCTCGAATTGCTCGACGGCGAGCAGCGCATCGGCCTTGGCGACGAAGCCGCGCTCGCGCAGTCTCGCG
CGGAAATCGCCGCGCTCGAGGTGGAGGAGCAATCGATCGATGCTTGCTGGCGGCAGCAGATCGAGGCCGC
GCAGACGCTGCTCAGCGCGCGCGAGGCGGCGGGCGACGCTGCGGCGAGCGCGATCGACGCGCTGCGCGAG
CTGGAGCATGCGCTGTCGAACCTGCAAGGCGATCACGCGTTCGTTTTCCCCGAGGTCAACGAAGCGATCG
TCGCGGAGATCATGTCCGACTGGACCGGCATTCCGGTCGGCAGAATGGTGACGGACGAAGTGTCCGCCGT
GCGCGCCTTGCCGGACACGCTCGCCGCCCGCGTGATCGGTCAACGCGATGCGTTGCATCAGATTGGCGAT
CGGGTGCAAACGGCGCGCGCCGGATTGACCGATCCGAAGAAGCCGCTCGGCGTGTTCCTGCTCGCGGGGC
CGTCGGGCGTCGGCAAGACGGAGACGGCATTGGCGCTTGCCGAGGCGCTGTACGGCGGCGAGCAGAATCT
CATCACGATCAACATGAGCGAATATCAGGAGGCGCATACGGTATCGGGGCTGAAGGGCGCGCCGCCGGGT
TACGTCGGATACGGCGAGGGCGGCGTGCTGACCGAGGCGGTGCGCAGGCGTCCGTATTCCGTCGTGCTCC
TCGACGAGATCGAGAAGGCGCATCCCGACGTCCACGAGATGTTCTTCCAGGTATTCGACAAGGGCTACAT
GGAGGACGGCGACGGGCGCTATATCGATTTTCGCAACACGACGATTCTTCTCACCAGCAATGCAGGCTCC
GACCTCGTGTCCGGACTGTGCATGGACGAGGCTTGCGCTCCCGACGCGGACGGCCTTTGCGCCGCGCTCG
CTTCCGAATTGCTCAAGACGTTTCCCGCGGCGTTTCTCGGGCGCGTGACGCTGGTGCCCTATCGTCCGCT
CGCGCAGGAAACGCTATCGCGCATCGTCCGGCTGCATCTGGACCGAGTGGTGACGCGAATGGCCGAGAAT
CAGGCTGTCGCCCTGCGTTATTCGGACAATGTCGTCGATTACGTCGTCAATCGCTGCCTCGTGCAGGAAA
CGGGGGCGCGCTTGCTGATCGGCTTCATCGAGCAGCATGTGTTGCCGCTGCTCGCGAAGCTCTGGCTGGA
TTCGCTTGCGTCCAAGCACGTGCTGACACGCGTCGACCTCGACGTGGCCGATCCCGCCGCGGCCCCGACC
GAAGCGTTCGCGCTGCGCGCTTCATGA