SecReT6
Protein ID: 76818466
SecReT6 ID94
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1622
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1979821..1980339 [-]
Producthypothetical protein
NoteTssE
UniProt IDQ3JI24
KEGG IDbpm:BURPS1710b_A1622
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 3.10E-20, Aligned region: 38..148
Protein Sequence: 172 a.a.     [Download]
>gi|76818466|ref|YP_336779.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MRHPEGRHRAAYLPSLLDRLQDDAPHALSESPDAYAPSADEMRRIVQRDLSLLLNTSNLDDEVDARRYPL
VSASVVNYGVPPLAGSYLHDRNRETIERLVRTAIAHFEPRLIADSLAIRPLAAQPGASYNKLTFEISALV
QWSPYPLELRIQSTFDLELNRVTLEKTTLNGN
 
Nucleotide Sequence: 519 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1980339-1979821 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCGGCATCCTGAAGGACGGCATCGGGCCGCCTATCTTCCGTCGCTGCTCGACCGGCTGCAAGACGACG
CGCCGCACGCGCTCAGCGAATCGCCCGATGCCTATGCGCCGAGCGCCGACGAAATGCGCCGCATCGTGCA
GCGAGACCTGAGCCTGTTGCTGAACACCAGCAATCTGGACGACGAGGTGGACGCCCGCCGCTATCCGCTC
GTGTCGGCATCTGTCGTCAACTATGGCGTGCCGCCTTTGGCGGGCAGCTATCTGCACGACCGGAACCGGG
AAACGATCGAGCGCCTCGTGCGCACCGCGATCGCCCACTTCGAGCCGCGCCTCATTGCGGACTCCTTGGC
GATCAGGCCGCTCGCGGCGCAACCGGGCGCCAGCTACAACAAATTGACGTTCGAAATCAGCGCGCTCGTG
CAATGGTCGCCGTATCCGCTGGAGTTGCGCATCCAGAGCACGTTCGACCTCGAATTGAATCGAGTCACGC
TCGAGAAGACGACGCTCAACGGAAATTGA