SecReT6
Protein ID: 76818570
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1199
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1505787..1507295 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ3JJ97
KEGG IDbpm:BURPS1710b_A1199
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-194, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|76818570|ref|YP_336356.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MNERAQTQADTRAAAQPVVARDEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTVGMTTDAYGSVK
QIIAEIDRKLSEQINLILHHQEFQTLEGAWRGLHYLVTNTETDELLKIKALPASRNELARTLKRYKGVAW
DQSPLFRKVYEEEYGQFGGEPFGCLVGDFHFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELANPRDLTKIFQNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTGAASHDRYT
WANSAYAMAANINRSFKLYGWCSSIRGVESGGAVQGLPCHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAQVVVEEIDDNPGYYASKFFLRPHYQLEGLTVSLRL
ISKLPSAKAAGE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1507295-1505787 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGAATGAACGTGCCCAAACCCAGGCCGACACGCGCGCCGCCGCCCAGCCCGTGGTCGCGCGCGACGAGT
TCGCCGCGCTGCTGCAAAAGGAGTTCAAGCCGAAGACGGCGGAGGCGCGCGAATCGGTCGAGCGCGCGGT
GCGCACGCTCGCGCAGCAGGCGCTCGAGCACACGGTCGGCATGACGACCGACGCTTACGGCAGCGTCAAG
CAGATCATCGCCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCTGATCCTGCATCATCAGGAGTTCC
AGACGCTCGAAGGCGCGTGGCGCGGCCTGCACTATCTCGTCACGAACACCGAGACCGACGAGCTGCTGAA
GATCAAGGCACTGCCCGCGTCGCGCAACGAGCTCGCGCGCACGCTCAAGCGCTACAAGGGCGTCGCGTGG
GATCAGAGCCCGCTGTTTCGCAAGGTCTACGAAGAAGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTCGTCGGCGATTTCCATTTCAACCACAGTCCGCCCGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCGGCGGCCGCGCATGCGCCGTTCATCGCGGGCGCGTCGCCCGAGCTGATGCAGATGGATTCGTGGCAG
GAGCTCGCCAATCCGCGTGATCTGACGAAGATCTTCCAGAACACCGAATACGCCGCGTGGCGCAGCTTGC
GCCAGTCCGAGGATTCGCGCTACGTCGGGCTCGCGATGCCGCGCTTTCTCGCGCGGCTGCCGTACGGCGC
GCGCACGAATCCCGTCGACGAATTCGACTTCGAGGAGGATACCGGCGCCGCGAGCCACGACCGCTACACG
TGGGCGAATTCCGCGTACGCGATGGCGGCGAACATCAACCGCTCGTTCAAGCTGTACGGCTGGTGCTCGT
CGATTCGCGGCGTCGAATCGGGCGGCGCGGTGCAAGGGCTGCCGTGCCACACGTTCCCCACCGACGACGG
CGGCGTCGACCAGAAATGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAGAAC
GGCTTCATGCCGTTCGTACATCGAAAGAATTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGCTGTATC
AGCCCGCCGAGTATCACGATCCCGACGCGACCGCGAACGCGCGGCTCTCGGGCCGCCTGCCGTACCTGTT
CGCGTGCTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTTCGCGAGCGC
GACGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGATCCGGCGAACTCGTCGC
AGGAGACGAAGGCGCGCAAGCCGCTCGCGGCCGCGCAGGTCGTCGTCGAGGAGATCGACGACAACCCCGG
CTATTACGCGTCGAAATTCTTCCTGCGGCCGCATTACCAACTGGAAGGGCTCACCGTGTCGCTGCGGCTC
ATCTCGAAGCTGCCGTCGGCGAAGGCGGCGGGCGAATGA