SecReT6
Protein ID: 76818593
SecReT6 ID94
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1620
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1976893..1977942 [-]
Producthypothetical protein
NoteTssG
UniProt IDQ3JI26
KEGG IDbpm:BURPS1710b_A1620
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 2.20E-98, Aligned region: 29..330
Protein Sequence: 349 a.a.     [Download]
>gi|76818593|ref|YP_336777.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MTAHPPAARPIDAHSPLHPDALRAWFDPQAPWRAGFLSLLRAIAARDTRMPLPGTACLPKEEAFRIGQRP
SMAFAPREIASLDVQRGRLDIQLFGLGLWGPQGPLPLHMTELAYNRAESYQDHAIAHFSNLFHHRALALF
YRAWASSQATVSLDRAEHETFSFYIGSLMGTDPEEAARTHPPTHARYAACAHLVREARNPDGVAATLSHY
FGVPIAVDEYVFHWIRIAPPERCLLGARAASTVMGEGALLGDMVADCQHKFRLVIGPLDLDQYLRLTPHG
NDLPTLVDWVRAFVGHEYDWEIKLLVKPRAAPPARADTTHRLGYSTWLGESRDDRPVVGMVFEPEKYCS
 
Nucleotide Sequence: 1050 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1977942-1976893 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGACGGCGCATCCGCCCGCCGCCCGGCCCATCGACGCCCACTCGCCCCTGCATCCGGACGCACTGCGGG
CATGGTTCGATCCGCAAGCGCCGTGGCGCGCCGGCTTTCTGAGCCTGTTGCGCGCAATCGCCGCACGCGA
CACGCGCATGCCCTTGCCCGGAACGGCGTGTCTGCCGAAGGAAGAGGCGTTTCGCATCGGACAACGGCCG
TCGATGGCCTTCGCGCCGCGCGAGATCGCATCGCTCGACGTGCAGCGCGGGCGTCTCGACATTCAGCTGT
TCGGCCTCGGCCTATGGGGGCCGCAGGGGCCGTTGCCGCTTCACATGACCGAGCTCGCGTACAACCGCGC
CGAGAGCTATCAGGATCATGCGATCGCGCATTTCTCCAATCTCTTTCACCATCGTGCGCTCGCGTTGTTC
TATCGTGCGTGGGCGTCGTCACAGGCGACCGTATCGCTCGATCGCGCCGAGCACGAAACGTTCTCGTTCT
ATATCGGCAGCCTGATGGGCACCGATCCCGAAGAAGCCGCGCGCACGCACCCGCCCACGCACGCGCGGTA
CGCCGCATGCGCGCATCTCGTGCGCGAGGCGCGCAATCCGGACGGCGTGGCCGCCACGCTGTCGCATTAC
TTCGGCGTGCCGATCGCCGTCGACGAATACGTCTTCCACTGGATCCGGATTGCGCCGCCGGAGCGTTGCC
TGCTCGGCGCGCGCGCCGCATCGACCGTCATGGGCGAGGGCGCGCTGCTCGGCGACATGGTTGCCGATTG
CCAGCACAAGTTCCGGCTCGTCATCGGCCCGCTCGATCTCGACCAATATCTTCGCCTGACGCCGCACGGC
AACGATCTGCCGACCCTGGTCGATTGGGTGCGCGCCTTCGTCGGTCACGAATACGACTGGGAGATCAAGC
TGCTCGTCAAGCCGCGCGCCGCGCCGCCCGCCCGCGCGGATACCACGCACCGCCTCGGCTATTCGACCTG
GCTCGGCGAATCGAGGGACGACAGGCCGGTCGTCGGCATGGTGTTCGAGCCGGAAAAATACTGTTCCTGA