SecReT6
Protein ID: 76818774
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0539
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]725396..726418 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ3JL55
KEGG IDbpm:BURPS1710b_A0539
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 6.50E-81, Aligned region: 11..311
Protein Sequence: 340 a.a.     [Download]
>gi|76818774|ref|YP_335698.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MPALEPVLLGEAKHFAYFQAIRLLRRIARERRGDAAGRPDAPLPIHTRPNLSLSFPDTDVERIDKADDGG
YRVVANFFGLYGVSSPLPTFYTEDLIDEAFRGRHAARGFLDVLHRALYPLLFDAWLKHRLALRIVEERDE
HALRPLYALAGVDARIARDAGLHEHALLRYVGLLSQRPRSAAGLRALLADAFAPATVDIEPCVPQWLPIP
DDQRTRVGARAHRLGADARVGARMRDDGARLRIVLGDVPGPLFRALMPGGDAFARLRLLVRLYLTQPFAV
DVVVRVRARDAAPARCGRRAWSRVGLDAWLGGPSAERAASPEFRLPTSLFDQARPHHAAG
 
Nucleotide Sequence: 1023 bp     [Download]
>gi|76817237|ref|NC_007435.1|:725396-726418 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCCTGCTCTAGAACCCGTTCTGCTCGGCGAGGCGAAGCACTTCGCGTATTTCCAGGCGATCCGGCTGC
TGCGGCGCATCGCGCGCGAACGGCGCGGCGACGCCGCGGGGCGGCCCGACGCGCCGCTGCCGATCCACAC
GCGGCCGAATCTCTCGCTGTCGTTTCCGGACACCGACGTCGAGCGCATCGACAAGGCCGACGACGGCGGC
TACCGGGTCGTCGCGAACTTCTTCGGTCTGTACGGCGTGTCCTCGCCGCTGCCGACGTTCTACACCGAGG
ACCTGATCGACGAAGCGTTCAGGGGCCGCCACGCGGCGCGCGGCTTTCTCGACGTGCTGCATCGCGCGCT
CTATCCGCTGCTGTTCGACGCGTGGCTCAAGCATCGGCTGGCGCTGCGGATCGTCGAGGAACGCGACGAG
CACGCGCTGCGCCCGCTCTACGCACTCGCGGGCGTCGACGCGCGCATCGCGCGCGACGCGGGCCTGCACG
AGCACGCGCTGCTGCGCTACGTCGGGCTGCTCAGCCAGCGGCCGCGCTCCGCGGCCGGTCTGCGCGCGCT
GCTCGCCGACGCGTTCGCGCCCGCGACGGTCGACATCGAGCCGTGCGTGCCGCAATGGCTGCCGATTCCG
GACGACCAGCGCACCCGCGTCGGCGCGCGCGCGCACCGGCTCGGCGCCGACGCGCGGGTCGGCGCGCGCA
TGCGCGACGACGGCGCCCGGCTGCGGATCGTGCTCGGCGACGTGCCCGGCCCGCTGTTCCGCGCGCTGAT
GCCGGGCGGCGATGCGTTTGCCCGGCTGCGCTTGCTCGTACGCCTGTATCTGACCCAACCGTTCGCCGTG
GACGTCGTGGTGCGCGTGCGCGCGCGCGACGCGGCCCCCGCGCGCTGCGGCCGCCGCGCGTGGTCGCGCG
TCGGGCTCGACGCGTGGCTGGGCGGCCCGAGCGCGGAACGCGCGGCGTCGCCCGAATTCCGTCTTCCGAC
TTCCCTCTTTGATCAAGCGAGACCCCATCATGCTGCTGGTTGA