SecReT6
Protein ID: 76818799
SecReT6 ID94
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1608
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1959532..1960974 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ3JI38
KEGG IDbpm:BURPS1710b_A1608
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.10E-143, Aligned region: 51..478
Protein Sequence: 480 a.a.     [Download]
>gi|76818799|ref|YP_336765.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MVPGIHAKDENQVERRCRAADGDDYRIGMIAMSWHNKVVWNEGLFLLPQLFQQQERYFEYFAHKRAAVLS
PFFWGFSRYEIDQESLSFGKLVFKSGAGIFPDGTPFDVPGHTPPPPPLTIAAEHQDQVIYLAVPLRLPNT
EETAFDEQAGSLARYSAFEIELRDSNAIGQGPKPVQLANMRLRLLPEKELTQSWIGIALTRVKTLHADGS
VALYDGDHIPPVSQYGANPLLREWATQLHGLAKLRADALATRLSGSDGRAGAAAEVADYLLLQVLNRYEP
LLEHICRIREMPPVTLYRELSMLAGELSTFVRPQTRRPRPTPGYDHAQLYASIRPLVDEVHYLLNQVLIR
GAQPIPLTEQPHGIRVATMLPSELAGYSSLVLAVGAQMSPDVLQQQFASQTKISHPQRLPELIRSHLPGM
TMIPLPVPPRQIPFNSSYIYYELSRTGPFWEQIAQQGGLAMHIAGHFPELKLELWGVRHK
 
Nucleotide Sequence: 1443 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1959532-1960974 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGTACCGGGCATTCACGCCAAGGACGAAAATCAAGTTGAACGTCGATGTCGGGCAGCAGACGGTGACG
ATTACAGAATTGGAATGATTGCGATGAGTTGGCATAACAAAGTGGTGTGGAACGAAGGACTGTTTCTTCT
TCCCCAGCTGTTTCAACAACAGGAACGGTATTTCGAATATTTCGCGCACAAGCGGGCCGCGGTCCTCAGC
CCGTTTTTCTGGGGATTCAGCCGATACGAAATCGATCAGGAGTCGCTATCGTTCGGCAAGCTCGTGTTCA
AGAGCGGTGCGGGAATATTTCCCGACGGAACGCCGTTCGACGTGCCGGGGCACACGCCGCCGCCGCCGCC
GCTGACGATCGCCGCCGAGCATCAGGATCAGGTGATTTATCTCGCGGTGCCGCTGCGTCTGCCGAATACG
GAGGAGACCGCGTTCGACGAACAAGCGGGATCGCTTGCGCGCTATTCGGCGTTCGAGATCGAATTGCGCG
ACAGCAATGCGATCGGTCAAGGGCCCAAGCCGGTACAGCTCGCGAACATGCGGCTGCGCCTGCTGCCGGA
AAAGGAGCTGACGCAGTCCTGGATCGGTATTGCCTTGACGCGCGTGAAGACGCTTCACGCCGACGGTTCG
GTCGCGCTGTACGACGGTGACCACATCCCGCCCGTCAGCCAGTACGGAGCGAACCCGCTGCTGCGCGAAT
GGGCGACCCAGTTGCATGGCCTCGCGAAACTGCGAGCCGACGCGCTGGCGACGCGCCTGTCCGGCAGCGA
TGGCCGGGCCGGGGCGGCGGCCGAGGTGGCGGATTATTTGTTGCTGCAGGTGCTGAACCGGTATGAACCG
CTGCTCGAGCACATCTGCAGGATTCGCGAAATGCCGCCCGTCACGCTCTATCGCGAGCTGTCGATGCTGG
CAGGCGAATTGTCGACGTTCGTGCGCCCGCAAACGCGCCGTCCGCGGCCGACGCCCGGTTACGATCATGC
GCAGTTGTATGCGAGCATTCGCCCGCTGGTCGATGAGGTGCACTACCTGTTGAACCAGGTTCTGATTCGA
GGCGCGCAGCCGATCCCGCTCACCGAGCAGCCGCACGGCATTCGCGTGGCCACGATGTTGCCGTCGGAAC
TCGCGGGCTATTCGAGCCTCGTGCTCGCCGTGGGCGCGCAAATGTCGCCGGACGTGTTGCAGCAGCAGTT
CGCATCCCAAACGAAGATCAGCCATCCGCAGCGGCTGCCGGAGCTCATTCGCTCTCATTTGCCGGGCATG
ACGATGATTCCGTTGCCGGTGCCTCCGCGGCAGATTCCGTTCAATTCCAGCTATATCTATTACGAGCTAT
CCCGCACGGGGCCGTTCTGGGAACAGATTGCGCAACAAGGCGGGCTGGCGATGCACATCGCGGGCCACTT
CCCTGAACTCAAGCTCGAACTTTGGGGAGTGCGTCACAAATGA