SecReT6
Protein ID: 76818810
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1207
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1517798..1519162 [-]
Productprotein ImpJ
NoteTssK
UniProt IDQ3JJ89
KEGG IDbpm:BURPS1710b_A1207
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 3.20E-159, Aligned region: 17..453
Protein Sequence: 454 a.a.     [Download]
>gi|76818810|ref|YP_336364.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MRQRVIWTEGMFLRPQHFQQLERHWERYVGMRCLPLQGFYWGYDELQIDRELLALGKVALLAATGVMRDG
TPFDLSHPDDRPEPLDVPADAKDQLVVLALPLWRGGAQEVSFGAGGNGEGHGGDGNAHAGFARYVVREYE
VADANEVALGPALLQTGRLNVRLMLESELTGDWQALGVARVVERRTDGRLLVDDGYIPPRLVAQRDPVLL
RHTRELHGLLTQRSEALGERLSEPGRGGVSEVADFLLLQLVNRYLALTWHAQQDVAAHPETLFCDWLKLA
CDLSTFTAAGRRPQSLAVYRHDDLRASFGELMAELRRSLSTVLEQNAIQIELRDVGNGMKVATIADPALR
DTAGFVLAVRADVPADSLRARFPAQAKLGPVERIRDLVQLQLPGIAMRQLPVAPRQIPYHAGHTYFEIDK
GGEMWKQLERSGGLAFHFAGEFPGLSMEFWAIRG
 
Nucleotide Sequence: 1365 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1519162-1517798 Burkholderia pseudomallei 1710b chromosome II, complete sequence
TTGCGCCAGCGCGTGATCTGGACCGAGGGCATGTTCCTGCGGCCGCAGCATTTCCAGCAGCTCGAGCGGC
ACTGGGAGCGCTACGTCGGCATGCGCTGCCTGCCGCTGCAAGGCTTCTACTGGGGCTACGACGAGTTGCA
GATCGATCGCGAGCTGCTCGCGCTCGGCAAGGTCGCGCTGCTCGCCGCGACCGGCGTGATGCGCGACGGC
ACGCCGTTCGACCTGTCGCATCCGGACGACCGGCCCGAGCCGCTCGACGTGCCCGCCGACGCGAAGGATC
AGCTCGTCGTGCTCGCGCTGCCGCTGTGGCGCGGCGGCGCGCAGGAGGTGTCGTTCGGCGCGGGCGGCAA
CGGCGAAGGCCACGGCGGCGACGGCAACGCGCACGCGGGCTTCGCGCGCTACGTCGTGCGCGAATACGAA
GTCGCCGACGCGAACGAGGTCGCGCTCGGCCCCGCGCTATTGCAGACCGGCCGCCTGAACGTGCGCCTGA
TGCTCGAATCCGAATTGACGGGCGACTGGCAGGCGCTCGGCGTCGCGCGCGTCGTCGAGCGGCGCACCGA
TGGGCGGCTGCTCGTCGACGACGGCTACATTCCGCCGCGGCTTGTCGCGCAGCGCGATCCGGTGCTGCTG
CGCCACACGCGCGAGCTGCACGGGCTGCTCACGCAACGCAGCGAGGCGCTCGGCGAGCGCCTGTCGGAGC
CGGGGCGCGGCGGCGTGTCCGAAGTCGCCGATTTCCTGCTGCTGCAACTCGTCAACCGCTATCTGGCGCT
CACGTGGCACGCGCAGCAGGATGTCGCCGCGCACCCGGAGACGCTGTTCTGCGATTGGCTGAAGCTCGCG
TGCGACCTGAGCACATTCACCGCGGCCGGCCGCCGGCCGCAGTCGCTCGCGGTCTACCGGCACGACGATC
TGCGCGCGAGCTTCGGCGAGCTGATGGCCGAGCTGCGCCGCTCATTGTCGACGGTGCTCGAGCAGAACGC
GATCCAGATCGAGCTGCGCGACGTGGGCAACGGCATGAAGGTCGCGACGATCGCCGATCCGGCGCTGCGC
GACACGGCGGGCTTCGTGCTCGCCGTGCGCGCCGACGTGCCGGCCGACAGCCTGCGCGCGCGCTTTCCCG
CGCAGGCGAAGCTCGGTCCCGTCGAGCGCATTCGCGATCTCGTGCAGTTGCAACTGCCGGGCATCGCGAT
GCGGCAGTTGCCCGTCGCGCCGCGGCAGATTCCGTATCACGCGGGCCACACGTACTTCGAGATCGACAAG
GGCGGCGAGATGTGGAAACAGCTCGAACGCTCGGGCGGCCTCGCATTTCATTTCGCCGGCGAATTCCCGG
GACTCTCGATGGAGTTCTGGGCGATTCGCGGGTGA