SecReT6
Protein ID: 76818832
SecReT6 ID95
T6SS typei3
Gene symbolsciG
Locus tagBURPS1710b_A1696
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2070046..2072973 [-]
ProductSciG protein
NoteTssH
UniProt IDQ3JHV0
KEGG IDbpm:BURPS1710b_A1696
PDB IDNA
Domain hit(s) vs Pfam AAA_2 [PF07724], Evalue: 3.50E-38, Aligned region: 231..265
AAA_2 [PF07724], Evalue: 3.50E-38, Aligned region: 684..850
AAA [PF00004], Evalue: 4.80E-20, Aligned region: 233..364
AAA [PF00004], Evalue: 4.80E-20, Aligned region: 689..772
AAA_5 [PF07728], Evalue: 9.40E-14, Aligned region: 233..311
AAA_5 [PF07728], Evalue: 9.40E-14, Aligned region: 688..806
ClpB_D2-small [PF10431], Evalue: 1.30E-13, Aligned region: 856..926
AAA_16 [PF13191], Evalue: 2.50E-08, Aligned region: 32..77
AAA_16 [PF13191], Evalue: 2.50E-08, Aligned region: 210..250
AAA_16 [PF13191], Evalue: 2.50E-08, Aligned region: 274..311
AAA_16 [PF13191], Evalue: 2.50E-08, Aligned region: 683..732
AAA_16 [PF13191], Evalue: 2.50E-08, Aligned region: 753..776
AAA_16 [PF13191], Evalue: 2.50E-08, Aligned region: 832..889
Sigma54_activat [PF00158], Evalue: 4.00E-07, Aligned region: 229..313
Sigma54_activat [PF00158], Evalue: 4.00E-07, Aligned region: 688..787
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 233..314
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 377..400
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 687..710
AAA_22 [PF13401], Evalue: 3.10E-06, Aligned region: 750..774
AAA_19 [PF13245], Evalue: 9.20E-06, Aligned region: 231..256
AAA_19 [PF13245], Evalue: 9.20E-06, Aligned region: 491..491
AAA_19 [PF13245], Evalue: 9.20E-06, Aligned region: 686..714
IstB_IS21 [PF01695], Evalue: 2.60E-05, Aligned region: 226..290
IstB_IS21 [PF01695], Evalue: 2.60E-05, Aligned region: 688..708
IstB_IS21 [PF01695], Evalue: 2.60E-05, Aligned region: 758..786
AAA_29 [PF13555], Evalue: 5.40E-05, Aligned region: 225..251
AAA_29 [PF13555], Evalue: 5.40E-05, Aligned region: 686..713
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 233..257
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 467..489
AAA_25 [PF13481], Evalue: 0.00012, Aligned region: 686..720
NACHT [PF05729], Evalue: 0.00013, Aligned region: 233..261
NACHT [PF05729], Evalue: 0.00013, Aligned region: 688..714
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 233..252
AAA_17 [PF13207], Evalue: 0.00016, Aligned region: 688..725
AAA_18 [PF13238], Evalue: 0.00021, Aligned region: 233..266
AAA_18 [PF13238], Evalue: 0.00021, Aligned region: 689..718
Zeta_toxin [PF06414], Evalue: 0.00028, Aligned region: 232..253
Zeta_toxin [PF06414], Evalue: 0.00028, Aligned region: 687..728
Clp_N [PF02861], Evalue: 0.0022, Aligned region: 28..74
Clp_N [PF02861], Evalue: 0.0022, Aligned region: 468..483
AAA_14 [PF13173], Evalue: 0.0025, Aligned region: 233..313
AAA_14 [PF13173], Evalue: 0.0025, Aligned region: 687..770
Protein Sequence: 975 a.a.     [Download]
>gi|76818832|ref|YP_336853.1| sciG gene product [Burkholderia pseudomallei 1710b]
MAISRQALFGKLGATLFRAIESATVFCKLRGNPYVELVHWLQQLLQQSDSDLHRIVRHAGIERDALDRDI
ARALAALPAGAGSISDFSHHVETAIERAWVLATLRFGDRRIRGAWLVAALVDTPELRRVLLSISPAFARI
PHDDALDDVLPAWTAGSPEAADAPYDHADSAPASPGEPSGATRAAPNGSPLERYCTDLTARARDGDIDPV
IGRELEIRTMTDVLLRRRQNNPLLTGEAGVGKTAVVEGLALAIANGDVPPKLADVRLMSVDVGALLAGAG
MKGEFESRLKGVLEAAAKSVAPVILFVDEIHTLIGAGGQAGTGDAANLLKPALARGTIRTIGATTWAEYK
RHIEKDPALTRRFQVLQVPEPEEPAAVHMVRGVARAFARHHRVTVRDEAIRAAVALSHRYIPSRHLPDKA
ISLLDTACARVALSQHAAPGELQHVRQRLLAARAERDLLEQEARIGLDAGQSLAAVRERIEALAAEEAAV
DARWKAQADAARALLAAREAALAECHRESCAETRAGSLSESRTESRTESRARSHIDSSACAHSDVPAEMH
AGSRTATRPDTHAEAHAAPASPPPAADTPHAGAAPGLRELERALAAAQGDAPLVFPEVDEAIVAQIVADW
TGIPVGRMMTDEVAAVRALPATLEARVIGQPDALRQIGERVQTARAGLADPKKPLGVFLLAGPSGVGKTE
TALALAEALYGGEQSLITINMSEYQEAHTVSGLKGAPPGYVGYGEGGVLTEAVRRRPYSVVLLDEIEKAH
RDVHELFFQVFDKGYMEDGDGRYIDFRNTTILLTSNVGAELSASLCADASLAPDAAALRDALMPELLKVF
PAAFLGRVSVVPYRPLEARALARIVRLHLDRVVARMAERHRIALAYDDAVVDYVVGRCLVQETGARLLIG
FIEQHVLPRLSALWLDAFPSKAALARIDIGVADAAAPAARALVFRPGQASRAGPPNAPLTAVQAG
 
Nucleotide Sequence: 2928 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c2072973-2070046 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGCGATCTCGCGTCAGGCGCTGTTCGGGAAACTCGGGGCTACGCTCTTCAGGGCGATCGAATCGGCCA
CGGTTTTCTGCAAGCTGCGCGGCAATCCGTACGTCGAGCTGGTGCACTGGCTGCAGCAGTTGTTGCAGCA
GTCCGACTCCGATCTGCACCGGATCGTGCGGCACGCCGGCATCGAGCGCGACGCGCTCGATCGCGACATC
GCGCGCGCGCTCGCCGCGCTGCCGGCCGGCGCGGGCTCGATCAGCGATTTTTCCCATCACGTCGAAACCG
CGATCGAGCGCGCATGGGTGCTCGCGACGCTGCGCTTCGGCGACCGGCGCATCCGCGGCGCATGGCTCGT
CGCCGCGCTCGTCGATACGCCGGAACTGCGGCGCGTGCTGCTTTCCATTTCGCCGGCGTTCGCGAGGATT
CCTCACGACGACGCTCTCGACGACGTGCTGCCCGCGTGGACGGCCGGTTCGCCGGAAGCGGCGGACGCGC
CGTACGACCACGCCGATTCCGCGCCCGCTTCGCCGGGCGAGCCGTCCGGCGCGACGCGCGCCGCGCCGAA
CGGCTCGCCGCTCGAGCGATATTGCACGGACCTGACCGCGCGCGCTCGCGACGGCGACATCGACCCCGTC
ATCGGGCGCGAGCTCGAAATCCGCACGATGACCGACGTGCTACTGCGGCGCAGGCAGAACAATCCGCTGC
TCACCGGCGAGGCGGGCGTGGGCAAGACGGCCGTCGTCGAGGGCCTCGCGCTCGCGATCGCGAACGGCGA
CGTGCCGCCGAAGCTGGCCGACGTGCGCCTGATGAGCGTCGACGTGGGCGCGCTGCTGGCCGGCGCGGGC
ATGAAAGGCGAATTCGAATCGCGCCTGAAAGGCGTGCTCGAGGCCGCGGCGAAATCCGTCGCGCCCGTCA
TCCTGTTCGTCGACGAGATTCACACGCTGATCGGCGCGGGCGGACAGGCCGGCACGGGCGACGCGGCGAA
CCTGCTCAAGCCCGCGCTCGCGCGCGGCACGATCCGCACGATCGGCGCGACGACATGGGCGGAGTACAAG
CGGCACATCGAAAAGGATCCCGCATTGACCCGCCGCTTTCAGGTGCTGCAAGTGCCGGAGCCCGAAGAGC
CGGCCGCGGTGCACATGGTGCGGGGCGTCGCGCGAGCGTTCGCGCGGCACCACCGCGTGACGGTGCGCGA
CGAGGCGATCCGCGCCGCCGTCGCGCTGTCGCACCGCTACATTCCGTCGCGGCATCTGCCGGACAAGGCG
ATCAGCCTCCTCGACACCGCATGCGCGCGCGTCGCGCTCTCGCAGCACGCCGCGCCCGGCGAACTGCAGC
ACGTGCGCCAGCGCTTGCTCGCGGCGCGCGCCGAGCGCGATCTGCTCGAACAGGAGGCGCGCATCGGGCT
CGACGCCGGGCAATCGCTCGCGGCGGTGCGCGAACGCATCGAAGCGCTCGCGGCCGAGGAAGCGGCCGTC
GACGCGCGCTGGAAGGCGCAGGCCGACGCGGCGCGCGCGCTGCTCGCCGCGCGCGAGGCCGCGCTCGCGG
AATGTCACCGCGAGTCTTGCGCCGAAACGCGCGCCGGCTCGCTCTCCGAATCTCGTACCGAATCTCGTAC
CGAATCGCGCGCCAGATCACACATCGACTCCAGCGCCTGTGCTCACAGCGACGTCCCGGCCGAAATGCAC
GCCGGTTCGCGCACCGCAACGCGTCCGGACACGCACGCCGAAGCGCACGCCGCCCCCGCCTCGCCCCCGC
CCGCCGCCGATACGCCGCACGCAGGCGCCGCCCCCGGGCTGCGCGAGCTCGAACGCGCGCTCGCGGCGGC
CCAGGGCGACGCACCGCTCGTGTTCCCGGAAGTCGACGAGGCGATCGTCGCGCAGATCGTCGCGGATTGG
ACCGGCATTCCGGTCGGCCGCATGATGACCGACGAAGTCGCCGCCGTGCGCGCGCTGCCCGCGACGCTCG
AGGCGCGCGTGATCGGCCAGCCCGACGCGCTGCGGCAGATCGGCGAGCGCGTGCAGACCGCGCGCGCGGG
CCTCGCCGATCCGAAGAAGCCGCTCGGCGTATTCCTGCTTGCGGGCCCGTCGGGCGTCGGCAAGACCGAA
ACGGCGCTCGCGCTCGCCGAGGCGCTGTACGGCGGCGAACAGAGCCTGATCACGATCAACATGAGCGAGT
ACCAGGAAGCCCACACCGTGTCGGGCCTCAAGGGCGCGCCGCCCGGCTATGTCGGCTACGGCGAGGGCGG
CGTGCTGACCGAGGCGGTGCGGCGGCGGCCGTACAGCGTCGTGCTGCTCGACGAGATCGAGAAGGCGCAC
CGCGACGTGCACGAACTCTTCTTCCAGGTCTTCGACAAGGGCTACATGGAAGACGGCGACGGCCGCTACA
TCGATTTCCGCAACACGACGATCCTGCTCACGAGCAACGTCGGCGCGGAACTGAGCGCGAGCCTGTGTGC
CGACGCATCGCTCGCGCCCGATGCCGCCGCGCTGCGCGACGCGCTCATGCCCGAACTGCTGAAGGTCTTC
CCCGCCGCGTTCCTCGGGCGCGTGAGCGTCGTGCCGTACCGGCCGCTCGAAGCGCGCGCGCTCGCGCGCA
TCGTGCGCCTGCATCTGGATCGCGTCGTCGCGCGCATGGCCGAGCGGCACCGCATCGCGCTCGCGTACGA
CGACGCCGTCGTCGACTACGTCGTCGGGCGTTGCCTCGTGCAGGAAACCGGCGCGCGGCTGCTGATCGGA
TTCATCGAGCAGCACGTGCTGCCTCGGCTGTCCGCGCTGTGGCTCGACGCGTTCCCGTCGAAGGCGGCGC
TCGCGCGCATCGACATCGGTGTGGCCGACGCGGCCGCGCCCGCGGCGCGCGCGCTCGTCTTCCGGCCCGG
CCAAGCAAGCCGGGCGGGGCCGCCGAACGCGCCGCTCACCGCCGTGCAGGCCGGCTAG