SecReT6
Protein ID: 76818999
SecReT6 ID96
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A2074
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2523043..2523591 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ3JGS8
KEGG IDbpm:BURPS1710b_A2074
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 1.30E-54, Aligned region: 11..159
Protein Sequence: 182 a.a.     [Download]
>gi|76818999|ref|YP_337225.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MVRQKDGQKFIGESRAPRVQIEYDVEVYGSQKKVELPFVAGVMADLSGDNVEPLGPVEDRRFQEIDVENF
DERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPADVVKRIPELSTLLEARNRLKELLTYMDGK
AAAEDVIQELLKSPQWANEADAAEQSGGAGEGGDHQPEEGAK
 
Nucleotide Sequence: 549 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2523043-2523591 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGTTCGACAAAAGGATGGACAGAAATTCATCGGGGAGAGTCGTGCGCCCCGCGTGCAGATTGAATACG
ACGTGGAGGTGTACGGCTCGCAGAAGAAGGTCGAGCTGCCGTTCGTCGCGGGCGTGATGGCGGACCTGTC
GGGCGACAACGTCGAGCCGCTCGGCCCGGTCGAGGATCGGCGCTTTCAGGAGATCGACGTCGAGAACTTC
GATGAGCGCATGGCGCAGATCGCGCCGTCGCTGAGCTATCACGTGAAGAACGTGCTGACCAACGACGGCA
CGCTGATTCCGATCGATCTGACGTTCACGTCGATGGAATCGTTCGAGCCGGCGGACGTCGTCAAGCGCAT
TCCCGAGCTGTCGACGCTGCTCGAGGCGCGCAACCGGCTGAAGGAGCTGCTGACCTACATGGACGGCAAG
GCGGCAGCCGAGGACGTGATCCAGGAATTGTTGAAGAGCCCGCAGTGGGCGAACGAGGCCGACGCGGCGG
AGCAATCCGGCGGCGCCGGCGAGGGTGGAGACCATCAACCGGAAGAGGGTGCGAAATGA