SecReT6
Protein ID: 76819028
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1692
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2066683..2067186 [-]
Productputative lipoprotein
NoteTssJ
UniProt IDQ3JHV4
KEGG IDbpm:BURPS1710b_A1692
PDB IDNA
Domain hit(s) vs Pfam T6SS-SciN [PF12790], Evalue: 1.40E-40, Aligned region: 14..160
Protein Sequence: 167 a.a.     [Download]
>gi|76819028|ref|YP_336849.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MHPTTPVAAVALALACAACASGAAKQKEPLRLELAVRAAPTVNPDDRSRPAPIVVSVYELKTDGAFNAAD
FFTLQGPDKTVLADDLLARERFQLRPGERRVIRRDADPAAGALGVVAAYRDLPNSVWRAAYPLPPARDAA
WYRFSSPKLKLTIELDTHAIRITEPGK
 
Nucleotide Sequence: 504 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c2067186-2066683 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCATCCGACCACCCCCGTTGCCGCCGTCGCGCTCGCGCTCGCGTGCGCCGCGTGCGCGAGCGGCGCGG
CCAAGCAGAAGGAGCCGCTGCGGCTCGAGCTCGCCGTGCGCGCCGCGCCCACGGTCAATCCGGACGATCG
GAGCCGGCCGGCTCCGATCGTCGTGAGCGTCTACGAGCTGAAGACCGACGGCGCATTCAACGCCGCCGAT
TTCTTCACGCTGCAGGGCCCGGACAAGACCGTGCTCGCCGACGATCTGCTCGCGCGCGAGCGTTTTCAAC
TGCGCCCCGGCGAGCGCCGCGTGATCCGGCGCGACGCCGATCCGGCGGCGGGCGCGCTCGGCGTCGTCGC
CGCGTACCGCGATCTGCCGAACTCGGTGTGGCGCGCGGCATATCCGCTGCCGCCCGCGCGGGACGCCGCA
TGGTATCGCTTCTCGTCGCCGAAGCTGAAGCTGACCATCGAGCTCGACACGCACGCGATCAGGATCACCG
AACCCGGAAAATGA