SecReT6
Protein ID: 76819067
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1702
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2078757..2079860 [+]
ProductImpA-like N-terminal family protein
NoteTssA
UniProt IDQ3JHU4
KEGG IDbpm:BURPS1710b_A1702
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 68..128
ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 140..154
ImpA-rel_N [PF06812], Evalue: 7.90E-21, Aligned region: 204..220
Protein Sequence: 367 a.a.     [Download]
>gi|76819067|ref|YP_336859.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MTPSRKPAGRAAAARTPKPDGWMAPVDAAAPCGADLEYDPEFVVLAAKVAPRAEAQYGDFVGSPEPVNWS
DVERDCRRLMMRSKDMRLAVLFARSRTRLAGATGLAEGIGLLAAWLAAFPDAIHPQADVDADRDAALEIR
RNALQALTDADGLLADVREIALTRSSATRLQVRDVERAFAQPRPGDALAPESVVRQLDDLHAQQPETLAG
FGDALAGLAAIGAWSGEHLGDYAPDLSALDALLRRIAGANARGDRAEAEPIAPAEADAPPASEAAAAHAH
ASPPRRREPAAQALAAAIAGEPAAQPVDRYAARELIRQARQWFEQHEPSSPIPILLRRAEHFVGKRYADV
VQAIPAELLALWSADET
 
Nucleotide Sequence: 1104 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2078757-2079860 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGACCCCCAGCAGAAAACCGGCCGGCAGGGCGGCTGCCGCGCGTACGCCGAAGCCCGACGGCTGGATGG
CGCCCGTCGATGCGGCCGCGCCGTGCGGAGCGGACCTTGAATACGATCCCGAGTTCGTCGTGCTCGCGGC
GAAGGTCGCGCCGCGCGCCGAAGCGCAGTACGGGGACTTCGTCGGCTCGCCGGAGCCGGTGAACTGGAGC
GACGTCGAGCGCGACTGCCGACGGCTGATGATGCGCAGCAAGGACATGCGCCTCGCGGTGCTGTTCGCGC
GCAGCCGCACGCGGCTTGCCGGCGCGACCGGGCTCGCGGAAGGCATTGGCTTGCTGGCCGCGTGGCTCGC
CGCGTTTCCCGATGCGATTCATCCGCAAGCCGACGTCGACGCGGACCGCGACGCGGCGCTCGAGATCCGG
CGCAACGCGCTGCAGGCGCTGACCGATGCCGACGGGCTGCTGGCGGACGTGCGCGAGATCGCGCTGACCC
GCTCGAGCGCGACGCGCCTGCAGGTGCGCGACGTGGAACGCGCGTTCGCGCAACCGCGGCCCGGCGATGC
GCTCGCGCCGGAATCGGTCGTGCGCCAGCTCGACGATTTGCACGCGCAGCAGCCGGAGACGCTCGCGGGC
TTCGGCGATGCGCTCGCGGGGCTGGCCGCGATCGGCGCCTGGAGCGGCGAGCATCTCGGCGATTATGCGC
CGGACCTGTCGGCGCTCGATGCGCTGCTTCGCCGGATCGCGGGCGCGAACGCGCGCGGCGATCGCGCGGA
GGCCGAGCCGATCGCGCCGGCCGAAGCCGATGCGCCGCCGGCGAGCGAGGCGGCGGCCGCGCACGCACAC
GCATCGCCGCCGCGGCGGCGCGAGCCTGCGGCGCAGGCACTCGCGGCTGCCATTGCGGGCGAACCGGCCG
CGCAGCCGGTGGATCGTTACGCGGCGCGCGAGCTGATCCGGCAGGCGCGCCAGTGGTTCGAGCAGCACGA
GCCGAGCAGCCCGATTCCGATTCTGCTCAGGCGCGCGGAGCATTTCGTCGGCAAGCGCTATGCGGATGTG
GTGCAGGCGATTCCCGCCGAGCTGCTCGCGCTGTGGAGCGCGGACGAAACCTGA