SecReT6
Protein ID: 76819105
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1690
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2063961..2065226 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ3JHV6
KEGG IDbpm:BURPS1710b_A1690
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 3.10E-68, Aligned region: 46..256
OmpA [PF00691], Evalue: 2.70E-17, Aligned region: 315..413
Protein Sequence: 421 a.a.     [Download]
>gi|76819105|ref|YP_336847.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MHHPDISAPAPTFDSVAATFARREPAPAPAGEPPAARLAAIRLARNPLLEAARVLLRALADMPERLDRDD
IPQLRLLLEQEVRLFQRLCEQANIRRDHMLGARYCLCTALDEAAMQTSWAQSASGNLGTWISEGLATSFH
EDRQGGDKVYLLIGRLMNSPHEHIDLLEVIYRILSLGFEGRYRYEADGQRKHETVRQRLYNEIASQRGPV
SVALSPHWQPGPRSRSAPFRDFPAWVTAAVLSLIALGLFGCFKYALSTRSADVQQRIAAIARMAPPAAPA
ELRLATLLAGEIAAGTLSVEENARRSSVTFRGDAMFAPGAAGVNPAMGPLIRKIAAEIAKVPGKVTVRGY
TDNQPIKSRQFASNEALSEERATQVMQMLQSAGVPASRLEALGKGGAEPIGDNRTPQGRALNRRVEITVA
R
 
Nucleotide Sequence: 1266 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c2065226-2063961 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGCATCATCCGGACATATCGGCTCCGGCCCCGACCTTCGATTCCGTCGCGGCGACGTTCGCGCGGCGCG
AGCCGGCGCCTGCGCCGGCCGGCGAGCCGCCCGCCGCGCGCCTCGCCGCGATCAGGCTCGCCCGCAACCC
GCTGCTCGAAGCCGCGCGCGTGCTGCTGCGGGCGCTCGCCGACATGCCCGAGCGGCTCGATCGCGACGAC
ATTCCGCAATTGCGACTGCTGCTAGAACAGGAGGTGCGCCTGTTCCAGCGGCTCTGCGAACAGGCGAACA
TCCGGCGCGACCACATGCTCGGCGCGCGCTACTGCCTGTGCACCGCGCTCGACGAGGCGGCGATGCAGAC
GTCGTGGGCACAATCGGCGAGCGGCAATCTCGGCACGTGGATCAGCGAGGGGCTCGCGACGTCGTTCCAC
GAGGATCGCCAGGGCGGAGACAAGGTCTATCTGCTGATCGGCCGGCTGATGAATTCGCCGCACGAGCACA
TCGACCTGCTCGAAGTCATCTATCGAATCTTGAGCCTCGGCTTCGAGGGCCGCTACCGTTACGAAGCCGA
CGGCCAGCGCAAGCACGAGACCGTGCGCCAGCGGCTCTACAACGAGATCGCATCGCAGCGCGGGCCGGTG
TCGGTCGCGCTGTCGCCGCACTGGCAGCCCGGCCCCCGCAGCAGGAGCGCGCCGTTTCGCGATTTCCCCG
CGTGGGTCACGGCCGCCGTGCTGTCGCTGATCGCGCTCGGGCTGTTCGGCTGCTTCAAGTACGCGCTGTC
GACGCGCAGCGCCGACGTGCAGCAGCGGATCGCCGCGATCGCGCGGATGGCGCCGCCCGCCGCGCCGGCC
GAGCTGCGCCTCGCGACGCTGCTCGCCGGCGAGATCGCGGCGGGCACGCTCAGCGTCGAAGAAAACGCGC
GCCGCAGCTCGGTGACGTTCCGCGGCGACGCGATGTTCGCGCCGGGCGCGGCCGGCGTAAACCCGGCGAT
GGGGCCGCTCATCCGGAAAATCGCGGCCGAGATCGCGAAGGTGCCGGGCAAGGTGACGGTGCGCGGCTAC
ACCGACAATCAGCCGATCAAAAGCCGCCAGTTCGCGTCGAACGAGGCGCTATCCGAAGAGCGCGCGACGC
AGGTCATGCAGATGCTCCAGAGCGCGGGCGTGCCCGCGAGCCGCCTCGAGGCGCTCGGCAAGGGCGGCGC
CGAGCCGATCGGCGACAACCGGACCCCGCAGGGCCGCGCGCTGAACCGCCGCGTCGAAATCACGGTCGCG
CGCTGA