SecReT6
Protein ID: 76819179
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0546
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]739737..740402 [+]
Producthypothetical protein
NoteTssL
UniProt IDQ3JL48
KEGG IDbpm:BURPS1710b_A0546
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.10E-44, Aligned region: 1..208
Protein Sequence: 221 a.a.     [Download]
>gi|76819179|ref|YP_335705.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAVCAWIDEALLN
SGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCLRLGFRGRYGYDGGDGPLDAI
RQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKARTRRRIARAGLSVGLPLAILLSLYLIYHVVIV
RMVDAVYPRLQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|76817237|ref|NC_007435.1|:739737-740402 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGAAGCTGACCGATTCGATGATGCCGCTCGTCGCGTATGCGCGGCAGCTCGCGCAATCGCCGCGCGGCG
ACGCCGCCGAAGTCGCGCTGCGGCTCGACATCCTGATCGAGCGCGCGCGCGACCACGCGGCGTGCGCGGG
CGCACCCGCGGCCGACGTCGACGACGCGCTGTTCGCGGTGTGCGCGTGGATCGACGAGGCGCTGCTGAAC
AGCGGCTGGGACGATGCCGATCGCTGGACGCTGCGGCTGCTGCAAAAGCGCTACTTCGATACGTCGCACG
CGGGCGTCGTGTTCTTCGAACGCCTCGGCACGCTCGACGGCGCGCGCGCGAGCGTGCTCGAGGTCTACCT
GCTGTGCCTGCGGCTCGGCTTTCGCGGCCGCTACGGCTACGACGGCGGCGACGGCCCGCTCGACGCGATC
CGCCAGCGCGCGCTCGATGCACTGTCGGCGCACGCGCCGCCGTGCGCCGCGGGCGAGCCGCCGTTTCCCG
CCGCCTATGCGCACGCCGGCCCGCACGCCGCCGCCGCGAAAGCGCGCACGCGCCGCCGGATCGCGCGCGC
GGGGCTGAGCGTCGGGCTGCCGCTCGCCATCCTGCTGTCGCTCTATCTGATCTATCACGTCGTCATCGTG
CGGATGGTCGACGCGGTGTACCCCAGGCTGCAATGA