SecReT6
Protein ID: 76819180
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1701
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2077675..2078760 [+]
ProductSciB protein
NoteTssG
UniProt IDQ3JHU5
KEGG IDbpm:BURPS1710b_A1701
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 8.30E-101, Aligned region: 24..325
Protein Sequence: 361 a.a.     [Download]
>gi|76819180|ref|YP_336858.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MARDMTQAAVADTALSPQALARLRAEPWRYGFLALLRRIGADARIDPIGKARRPQAEPFRLGQQPSLAFA
PREIASVGDANGRLKVRLFGLGMLGPNGPLPIHVTEIARDREESRRDPTLGNFLDIFHHRYLTLLYRAWA
SAQAAAGLDRPDDERFSFYVASLAGQDLDEVGARPLPAHARLSASPHLVREARNADGLRMTLERYFGVPV
TLEENVFHWIAVDPLEHSRLGRPGDASTMAAGALLGELVPDRQHKFRLVFGPLDIDAYLRFTPRGEDLPR
LVEWVRAFVGYEFEWELELRIKPNGAPPAVMGGPHQLGWSGWLGRSPSGEPVTGMRFEPEHYAHGFARGT
ARDTRGMRGER
 
Nucleotide Sequence: 1086 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2077675-2078760 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGCGCGCGACATGACGCAGGCGGCCGTTGCCGACACGGCGCTGTCGCCGCAAGCGCTCGCGCGGCTGC
GCGCCGAACCGTGGCGCTATGGGTTCCTCGCGCTGCTGCGCCGCATCGGCGCGGACGCGCGCATCGATCC
GATCGGCAAGGCGAGGCGCCCGCAGGCGGAGCCGTTTCGCCTCGGCCAGCAGCCGAGCCTCGCGTTCGCG
CCGCGCGAGATCGCCAGCGTCGGCGACGCGAACGGGCGGCTCAAGGTGCGGCTGTTCGGGCTCGGGATGC
TGGGGCCGAACGGGCCGCTGCCGATCCACGTGACGGAGATCGCGCGCGATCGCGAGGAGAGCCGGCGCGA
TCCGACGCTCGGCAATTTTCTCGATATCTTCCATCATCGCTATCTGACGCTGCTGTATCGCGCGTGGGCG
TCGGCGCAGGCGGCGGCCGGCCTCGATCGTCCGGATGACGAACGGTTTTCGTTCTACGTCGCGAGCCTCG
CCGGCCAGGATCTCGACGAGGTCGGCGCGCGGCCGCTGCCCGCGCACGCGCGGCTGTCCGCCTCGCCGCA
TCTGGTGCGCGAGGCGCGCAACGCGGACGGCCTGCGAATGACGCTCGAACGTTACTTCGGCGTGCCGGTG
ACGCTGGAGGAAAACGTATTTCACTGGATCGCCGTCGATCCGCTCGAGCACAGCCGGCTCGGCCGGCCCG
GCGACGCATCGACGATGGCTGCGGGCGCGCTGCTCGGCGAGCTGGTGCCGGATCGGCAGCACAAGTTCCG
GCTCGTGTTCGGGCCGCTCGACATCGACGCCTATCTGCGCTTCACGCCGCGGGGCGAGGATCTGCCGCGG
CTCGTCGAATGGGTGCGGGCGTTCGTCGGCTACGAGTTCGAGTGGGAGCTCGAGTTGCGGATCAAGCCGA
ACGGCGCGCCGCCCGCCGTGATGGGCGGCCCGCATCAACTCGGCTGGTCGGGCTGGCTCGGCCGCTCGCC
GTCCGGCGAGCCGGTGACGGGCATGCGTTTCGAACCCGAGCACTATGCGCACGGGTTCGCGCGCGGCACG
GCTCGCGACACGCGCGGCATGCGAGGTGAACGATGA