SecReT6
Protein ID: 76819194
SecReT6 ID94
T6SS typei3
Gene symbolompA2
Locus tagBURPS1710b_A1604
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1954129..1955805 [+]
ProductOmpA family protein
NoteTagL
UniProt IDQ3JI42, Q3JI42
KEGG IDbpm:BURPS1710b_A1604
PDB IDNA
Domain hit(s) vs Pfam OmpA [PF00691], Evalue: 1.00E-18, Aligned region: 441..537
DUF218 [PF02698], Evalue: 0.00059, Aligned region: 446..517
Protein Sequence: 558 a.a.     [Download]
>gi|76819194|ref|YP_336761.1| ompA2 gene product [Burkholderia pseudomallei 1710b]
MSRQIRFWLVWGAIPFVVLASLCLPLRMQPEWSHVLTIVLVIAAIVLAIEIFEHSRETAQDRTAEAEIDD
HELAVIIVAGPHASSLFNSSGDDTAFRREAGALWLRADSVEQLRDTMMRVKASRGRFPDAAVVPLVSESD
DESDMRQAFAKWRTELREALCYPDAAYVLPCYLAVYTCLGFKGADGARPKWTGDAIEIGTRQMNAASKVG
ELLASIRQQLLRPSPTGSSAQCALGLGVFDWLDATALLSSMTMLANTPPFMLKGLTLADVGRRPIRPGAW
TRWLTVRTGLHIRQTKSSMAPLPVPRVAKHAESGIREGWSSARHLVSTRASFVPALVFSTVSTLGIAVAV
SGWMNSRMIQRVSNDIADYRSGADEWIGRKRFAQARLEHDRTAIVQTLLDGVPTGFGWGLYRGQELLVKL
DTVLDSPRAASIAMQLDTVSLFAAGKATFSPGAAQRELQHALRMILANPEQRVLIVGHADSSGSDAANFQ
LSEARARAIRDWFVDQGVLKTRFIVQGAGDTHPIADNDSPSGRAQNRRVEVLLIPDVSSDRKASGTEL
 
Nucleotide Sequence: 1677 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1954129-1955805 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGTCGCGTCAGATTCGATTTTGGCTCGTATGGGGCGCCATACCCTTCGTGGTGCTCGCGAGCCTTTGCC
TGCCGTTGCGCATGCAGCCGGAATGGTCTCATGTGCTGACCATCGTTCTGGTCATTGCCGCCATCGTGCT
GGCGATCGAAATATTCGAACACTCTCGCGAGACAGCGCAAGACCGAACGGCCGAAGCCGAAATCGACGAT
CACGAACTGGCGGTGATCATCGTCGCGGGCCCTCACGCATCGTCGCTTTTCAATAGCAGCGGGGACGATA
CGGCGTTTCGGCGCGAAGCCGGCGCGTTATGGCTGCGCGCCGACAGCGTCGAGCAATTGCGAGACACGAT
GATGCGCGTCAAGGCGTCGCGCGGACGGTTCCCGGACGCCGCCGTGGTGCCGCTCGTATCGGAAAGCGAT
GACGAAAGCGACATGAGGCAGGCGTTCGCGAAGTGGCGAACCGAACTCCGCGAAGCGCTTTGCTATCCCG
ATGCGGCCTATGTCCTGCCTTGCTATCTCGCCGTCTACACGTGTCTTGGATTCAAGGGAGCCGACGGCGC
GCGTCCGAAGTGGACGGGCGATGCAATAGAAATCGGCACGAGGCAGATGAATGCCGCATCGAAAGTGGGC
GAGCTGCTCGCATCGATTCGACAACAATTGCTTCGGCCGTCGCCCACCGGTTCGTCGGCGCAGTGCGCGC
TGGGGCTCGGCGTGTTCGATTGGCTCGACGCCACGGCGCTGCTGTCGTCGATGACCATGCTGGCGAATAC
CCCGCCATTCATGCTGAAAGGGCTGACGCTCGCGGATGTCGGCAGACGGCCGATACGTCCGGGAGCGTGG
ACGCGCTGGCTCACTGTTCGGACCGGTCTCCATATTCGCCAGACCAAATCGTCGATGGCGCCGCTTCCCG
TGCCGCGCGTGGCGAAGCATGCCGAAAGCGGCATTCGGGAAGGATGGAGCAGCGCGCGCCATCTCGTTTC
CACTCGTGCGAGCTTCGTGCCGGCGCTCGTGTTCTCCACTGTTTCGACGCTGGGCATCGCCGTGGCGGTC
TCGGGCTGGATGAACAGCCGCATGATCCAGCGGGTGTCGAACGATATCGCGGATTATCGGAGCGGAGCCG
ACGAGTGGATCGGGAGGAAGCGCTTTGCGCAGGCCCGCCTCGAACACGATCGCACGGCGATCGTGCAGAC
GCTGCTCGATGGCGTACCGACCGGTTTCGGCTGGGGACTCTACCGGGGGCAGGAGTTGCTGGTCAAGCTC
GATACGGTGCTGGATTCGCCGCGCGCGGCGTCGATCGCGATGCAGCTCGACACGGTATCGCTGTTCGCCG
CAGGCAAGGCTACATTTTCTCCGGGCGCCGCGCAGCGTGAGTTGCAACATGCATTGCGGATGATTCTCGC
CAATCCGGAGCAACGTGTGCTGATCGTCGGTCATGCAGACAGCTCCGGCTCGGATGCGGCCAATTTTCAG
TTATCCGAAGCGCGTGCGCGCGCGATTCGTGACTGGTTCGTCGATCAAGGCGTGCTGAAGACGCGCTTCA
TCGTGCAAGGAGCCGGCGATACGCATCCGATCGCCGATAACGACAGCCCTTCGGGACGTGCGCAGAATCG
CCGTGTCGAGGTCTTGCTGATTCCGGACGTTTCTTCCGACAGGAAGGCGAGCGGTACGGAACTATAG