SecReT6
Protein ID: 76819204
SecReT6 ID94
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1614
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1969703..1969972 [+]
ProductRhs family protein
NotePAAR
UniProt IDQ3JI32
KEGG IDbpm:BURPS1710b_A1614
PDB IDNA
Domain hit(s) vs Pfam PAAR_motif [PF05488], Evalue: 1.90E-15, Aligned region: 3..21
PAAR_motif [PF05488], Evalue: 1.90E-15, Aligned region: 7..81
PAAR_motif [PF05488], Evalue: 1.90E-15, Aligned region: 72..88
Protein Sequence: 89 a.a.     [Download]
>gi|76819204|ref|YP_336771.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MTIPAARVGDAIGHGGVLVTGSGDVFMNGIPAGFVAGSVAVCALHASAQAVVAASGTVFINRLPAAFVGG
VTSCGAPIVSGSPDVMIGS
 
Nucleotide Sequence: 270 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1969703-1969972 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGACAATCCCGGCAGCAAGAGTGGGAGATGCGATCGGACATGGCGGCGTTCTCGTCACCGGCTCAGGTG
ACGTATTCATGAACGGCATTCCCGCGGGATTCGTCGCCGGCAGCGTCGCCGTGTGCGCGCTGCATGCGTC
CGCGCAGGCGGTGGTCGCCGCATCGGGAACGGTATTCATCAATCGCCTCCCGGCTGCGTTCGTCGGTGGC
GTGACGTCGTGCGGCGCGCCGATCGTTTCAGGCTCGCCCGACGTCATGATCGGCTCATAA