SecReT6
Protein ID: 76819320
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1210
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1520812..1522248 [+]
ProductFHA domain-containing protein
NoteFha
UniProt IDQ3JJ86
KEGG IDbpm:BURPS1710b_A1210
PDB IDNA
Domain hit(s) vs Pfam FHA [PF00498], Evalue: 5.50E-10, Aligned region: 29..96
Protein Sequence: 478 a.a.     [Download]
>gi|76819320|ref|YP_336367.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MQLTVIEHAGEPVGTDGRNAVVFHAPGGTIGRDSDNHLVLRDDTRQISRLQALLQVADDACLLKNLSSVS
TIEVNRVPIGYAQAQRLNMGDIIRIGPYLLRAEPDDATIERTVEAAATAAAAAAPAASAAQAQAKGAGNK
LWGLLHERFGLGKAQGAGEQSGARAAPARHHDSPASAAPRDLNQLSTDPLDLFAQPHGDPDARAGAAREG
EDRAPPTVTQPDHAPEWTQHVRVQPAQSAPPAASRPGAPAARSGDIPAAGDASDMPSRVRASPAPAPATP
ETLLQAFFEGAGLDTAAEQHHWSAEQLFVAGQLLALFANGTVELLSSRSILKREVKADMTMLLDRENNPL
KLLPDGSAVLRQMFGLPLPGFMTPQSAVSDAFQDLHAHQIGMVAGMRAALMDLLTRFSPQRLRERDAPPQ
WYEKRVPALYKARLWDRYATTHRDTLFAIEDDFASVFGKAFLSAYDAEVESYRGRCRR
 
Nucleotide Sequence: 1437 bp     [Download]
>gi|76817237|ref|NC_007435.1|:1520812-1522248 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCAACTGACCGTTATCGAACACGCGGGCGAGCCGGTCGGCACCGACGGCCGCAACGCCGTCGTGTTTC
ATGCGCCGGGCGGCACGATCGGCCGGGACAGCGACAATCACCTCGTGCTGCGCGACGACACCCGGCAGAT
TTCGCGCCTGCAGGCGCTGCTGCAGGTGGCCGACGACGCGTGCCTGCTGAAGAACCTGAGCAGCGTATCG
ACGATCGAAGTGAACCGCGTGCCGATCGGCTACGCGCAGGCGCAGCGCCTGAACATGGGCGACATCATCC
GGATCGGCCCTTACCTGCTGCGCGCGGAGCCCGACGACGCGACGATCGAGCGAACCGTCGAAGCCGCCGC
CACGGCGGCCGCGGCGGCGGCGCCGGCGGCGTCCGCCGCGCAGGCTCAGGCGAAGGGGGCGGGCAACAAA
CTGTGGGGCCTGCTGCACGAGCGCTTCGGGCTCGGCAAGGCACAGGGCGCGGGCGAGCAGTCCGGCGCGC
GCGCCGCGCCGGCGCGCCACCACGATTCGCCGGCGTCCGCCGCGCCGCGCGACCTGAATCAGCTGTCGAC
CGATCCGCTCGACCTGTTCGCGCAGCCGCACGGCGATCCGGATGCGCGAGCCGGCGCCGCGCGCGAAGGC
GAAGACCGCGCGCCGCCCACCGTCACGCAACCGGATCACGCGCCCGAGTGGACGCAACACGTCCGCGTGC
AGCCGGCACAATCCGCGCCGCCCGCCGCCTCTCGCCCCGGCGCGCCCGCCGCGCGTTCGGGCGATATCCC
CGCAGCGGGCGATGCGAGCGACATGCCGTCGCGCGTGCGCGCGTCGCCGGCCCCCGCGCCGGCGACACCC
GAGACATTGCTGCAGGCGTTCTTCGAAGGCGCGGGGCTCGACACCGCCGCCGAGCAGCATCACTGGTCCG
CCGAGCAGTTGTTCGTCGCGGGGCAGCTGCTCGCGCTGTTCGCCAACGGCACGGTCGAGCTGCTGTCGTC
ACGCAGCATCCTGAAGCGCGAAGTGAAGGCCGACATGACGATGCTGCTCGACCGCGAGAACAATCCGCTG
AAGCTGCTGCCGGACGGCAGCGCGGTGCTGCGCCAGATGTTCGGGCTGCCGCTGCCGGGCTTCATGACGC
CGCAAAGCGCCGTGTCCGACGCGTTCCAGGATCTGCACGCGCACCAGATCGGCATGGTGGCCGGCATGCG
CGCCGCGCTGATGGATCTGCTCACGCGCTTCTCGCCGCAGCGCCTGCGCGAGCGCGACGCCCCGCCCCAG
TGGTACGAGAAGCGCGTGCCGGCGCTGTACAAGGCGCGCCTCTGGGACCGCTATGCAACCACGCATCGCG
ACACGCTGTTCGCGATCGAGGACGATTTCGCCTCCGTGTTCGGCAAGGCGTTCCTCAGCGCCTACGACGC
GGAAGTCGAGAGCTATCGCGGACGCTGCCGCCGGTGA