SecReT6
Protein ID: 76819401
SecReT6 ID96
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A2073
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2522107..2523009 [+]
Producthypothetical protein
NoteTssA
UniProt IDQ3JGS9
KEGG IDbpm:BURPS1710b_A2073
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 1.10E-16, Aligned region: 34..92
Protein Sequence: 300 a.a.     [Download]
>gi|76819401|ref|YP_337224.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MLDFDEDFIKIDAAICEYDSVGYAPQRKGESAFQWASIETGCLALLKKAKDVRVGIWHLRACIARRGLSG
LADGVRSLADLMSAPVEELHPRALPDESPGETLLIHLGWLAGPQFLHQLGSSRFEDRDATLNDLIGGRAA
AIVEDRDYRLRANTLVHDIQDSLSRIRESIAAAEQELNVSRALDLLSVAASRLTQAQAGGADSASVESDA
PVDAPAGASAPGAQQPMAGPGGVLRSRQEVGAALDRIVEYFRVHEPSHPAPIFLSRIQRMLGAGFEEVMA
ELYPEAASLVAQLSRPQSSK
 
Nucleotide Sequence: 903 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2522107-2523009 Burkholderia pseudomallei 1710b chromosome II, complete sequence
TTGCTGGATTTCGACGAAGACTTTATCAAGATCGACGCAGCCATCTGCGAATACGATTCCGTCGGTTACG
CGCCGCAACGCAAAGGAGAGAGTGCGTTCCAGTGGGCGTCCATCGAAACGGGATGTCTCGCTTTGTTGAA
GAAGGCGAAGGATGTCCGGGTCGGCATTTGGCATCTGCGCGCATGCATCGCGCGGCGCGGGCTGAGCGGG
CTGGCAGACGGCGTTCGATCGCTGGCCGATCTGATGAGTGCGCCCGTCGAGGAATTGCATCCTCGCGCGC
TGCCTGACGAATCGCCCGGCGAAACCCTCCTGATTCATCTCGGCTGGCTTGCGGGCCCGCAGTTCCTGCA
TCAGCTCGGCAGTTCCCGGTTCGAAGACCGGGACGCAACCCTCAACGATCTGATCGGCGGGCGCGCCGCG
GCGATCGTGGAGGATCGCGACTATCGCCTTAGAGCGAATACTCTTGTACATGACATTCAGGATTCCTTAT
CGCGAATTCGGGAATCGATCGCCGCGGCCGAGCAAGAGCTCAACGTCTCGCGCGCGCTCGACCTGTTGAG
CGTCGCGGCGTCTCGGCTCACGCAGGCACAAGCCGGCGGCGCGGACAGCGCAAGCGTCGAGAGCGACGCG
CCGGTCGATGCGCCGGCCGGCGCGTCCGCGCCCGGCGCGCAGCAGCCGATGGCGGGGCCGGGCGGCGTGT
TGAGGTCGAGACAGGAGGTCGGCGCGGCGCTCGATCGGATCGTGGAGTACTTCCGCGTGCACGAGCCGAG
CCATCCGGCGCCGATCTTCCTGTCGCGGATTCAACGAATGCTGGGGGCGGGTTTCGAGGAAGTGATGGCG
GAGCTCTATCCCGAGGCGGCATCTCTCGTGGCCCAACTGAGCCGGCCGCAGAGTTCCAAGTAA