SecReT6
Protein ID: 76819512
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0532
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]718340..720169 [-]
Productsensor histidine kinase
NoteVirA
UniProt IDQ3JL62
KEGG IDbpm:BURPS1710b_A0532
PDB IDNA
Domain hit(s) vs Pfam HATPase_c [PF02518], Evalue: 3.00E-21, Aligned region: 454..587
MASE1 [PF05231], Evalue: 2.00E-15, Aligned region: 62..323
HisKA [PF00512], Evalue: 0.00055, Aligned region: 311..338
HisKA [PF00512], Evalue: 0.00055, Aligned region: 337..402
Protein Sequence: 609 a.a.     [Download]
>gi|76819512|ref|YP_335691.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MHGNSIDAGPPARARPARITRTARAAPRRDDRAFAPGGALNAAGLLLLLFYANHLLSRPGACTSLNHTLS
AVVWPAPVLGIALLLHCRRPLAWWLGAGSLFATLLAAGSLDWVPWHVDALFAAVNVVEAIAGAWLARRYL
IAGGGVDTLRGFAMFVLLLPLGMAAMHATLAAAILSVWMNDREWLSEWSRAYAANALALLVLLPALLTWN
ARACGAAWSRSRNQLPVLATFGSLCFASIWGYQAEVARALLALSLSWAALEGGLVLASQLNALSAIALIA
MTLGGRGPYAWHHDGHGVWALQVDLIGVAILSMCIAIATGERRRLARQIERSRRFESLGFFAGGIVHDFS
NVLTTIDCHAEYASERLASGARADDSIDEIHRAVERGRDLAAQILLAARRGEPVLTRVSVDEVVDEALAA
TRAAAWRGVEIVRCGDGARDGARRGDVRHVVFADRSQLARAVMNLVGNAVRAARATVVVRVGVNGGVNGG
ASDGASRGAPAARAFDVAIGEASMPGGVWIEVSDDGEGIDVEPLDRIFEPFYSNRSGAPGTGLGLAIVAG
AALAHRGQIAVATDRGVGSCFRFTLPAAWGTGAPGAMDAGAPGAVQERT
 
Nucleotide Sequence: 1830 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c720169-718340 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGCACGGAAATTCCATCGATGCCGGGCCGCCCGCGCGCGCCCGGCCCGCACGCATCACGCGAACGGCGC
GCGCCGCGCCGCGCCGCGACGATCGCGCGTTCGCGCCGGGCGGCGCGCTGAACGCGGCGGGGCTGCTGCT
GCTGCTGTTCTACGCGAATCATCTGCTGTCCCGGCCCGGCGCGTGCACGTCGCTCAATCACACGCTGTCG
GCCGTCGTGTGGCCCGCGCCGGTGCTCGGCATCGCGCTGCTGCTGCACTGCCGGCGGCCGCTCGCATGGT
GGCTCGGCGCGGGTTCGCTGTTCGCCACGCTGCTCGCCGCGGGCTCGCTCGACTGGGTGCCGTGGCACGT
CGACGCGCTGTTCGCGGCCGTCAACGTCGTCGAGGCGATCGCGGGCGCGTGGCTCGCGCGGCGCTATCTG
ATCGCGGGCGGCGGGGTGGACACGCTGCGCGGCTTCGCGATGTTCGTGCTGCTGCTGCCGCTCGGCATGG
CGGCGATGCACGCGACGCTCGCGGCGGCGATCCTGTCGGTGTGGATGAACGACCGCGAATGGCTGAGCGA
ATGGTCGCGCGCGTATGCGGCGAACGCGCTTGCGCTGCTCGTGCTGCTGCCGGCGCTCCTCACGTGGAAC
GCGCGCGCATGCGGCGCGGCGTGGTCGCGCAGCCGCAATCAGTTGCCGGTGCTCGCGACGTTCGGCTCGC
TGTGCTTCGCGTCGATATGGGGATACCAGGCCGAGGTCGCGCGCGCGCTGCTCGCGCTGTCGCTGAGCTG
GGCCGCGCTCGAGGGCGGCCTCGTGCTCGCGTCCCAGCTCAACGCGCTCTCGGCGATCGCCCTGATCGCG
ATGACGCTCGGCGGGCGCGGCCCGTATGCGTGGCATCACGATGGCCACGGCGTCTGGGCGCTGCAGGTCG
ATCTGATCGGCGTCGCGATCCTGTCGATGTGCATCGCGATCGCGACGGGCGAGCGGCGGCGGCTTGCGCG
GCAGATCGAACGATCGCGCCGTTTCGAGTCGCTCGGCTTTTTCGCCGGCGGAATCGTGCACGATTTCAGC
AACGTGCTGACGACGATCGATTGCCACGCCGAATACGCGTCCGAGCGGCTCGCGAGCGGCGCGCGCGCGG
ACGATTCGATCGACGAGATTCATCGCGCGGTCGAACGCGGCCGCGATCTGGCGGCGCAGATCCTGCTCGC
CGCGCGCCGCGGCGAGCCCGTGCTGACGCGGGTGAGCGTCGACGAGGTCGTCGACGAGGCGCTCGCCGCG
ACACGCGCGGCCGCGTGGCGCGGCGTCGAGATCGTTCGATGCGGCGATGGCGCGCGCGACGGCGCCCGGC
GTGGCGACGTTCGTCACGTCGTATTCGCCGATCGCAGCCAGCTCGCGCGCGCGGTCATGAATCTCGTCGG
CAATGCGGTGCGCGCGGCGCGCGCGACGGTTGTCGTGCGTGTCGGGGTGAACGGCGGGGTGAACGGCGGC
GCGAGCGATGGGGCGAGCCGCGGCGCGCCGGCCGCTCGCGCATTCGACGTCGCGATCGGCGAAGCGTCGA
TGCCGGGCGGCGTGTGGATCGAGGTGAGCGACGACGGCGAAGGCATCGACGTCGAGCCGCTCGACCGCAT
CTTCGAGCCGTTCTATTCGAACCGCTCCGGCGCGCCGGGGACGGGGCTGGGTCTCGCGATCGTCGCGGGC
GCGGCGCTCGCGCACCGCGGGCAGATCGCCGTCGCGACGGATCGGGGCGTGGGCAGTTGCTTCCGGTTCA
CGTTGCCGGCGGCATGGGGAACGGGCGCGCCCGGCGCAATGGACGCCGGCGCGCCCGGCGCAGTACAGGA
GAGGACATGA