SecReT6
Protein ID: 76819516
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1700
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2075786..2077675 [+]
ProductSciC protein
NoteTssF
UniProt IDQ3JHU6
KEGG IDbpm:BURPS1710b_A1700
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.90E-214, Aligned region: 5..626
Protein Sequence: 629 a.a.     [Download]
>gi|76819516|ref|YP_336857.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MDPQLLDYYNQELIYMRELGAEFARAHPKIARRLGMQAGEVADPYVERLIESFCFMAARMQIKLDAEFPR
FTGRLLEVLYPTYVAPTPSMAVARLYPSRTEGNLAQGFRVARGTAFAARVPAGEKTACRFRSGQDVTLYP
LEIADARLTGIPPDIPALDRYVPAGAQVRGALRLRLRTTGNMRIADLRGLDRLPLYLAGDAQVASHLFEL
LHVAGVATLTAAPGEFAAPGRPPAAVTVDALAHEGLGADEGLLPLTWAKFHGHNLLHEYFACPERFYFVA
LTGLEEGLRRIAGSEVEIVVLLEQSPERLADVVDASRFALFCTPVINLFPRHMDRIELSSGQTECHLVPA
RLAPLDYEVFSVEAMYGQVAATSAELEFRPLYQTLNDDESNYGRYFSTRRERRLVSDFARRYGTRTPYVG
TEMFVSLVDQNEAPYSEDIRYLSVDALVTNRDLPSLVPRDGVRDLTAIESAPIDSVGLIRAPSAPKAPYA
EREIAWRLIRQLNFNYLPLDELDHRAGGQGLRGLLRLFLAGDEADSRRQVESLVGVKTRPVTRKLPGAGP
LVFGRGVECALSVDETGFSGVSPYLFGLVLEHYLARHVSINVFTQTELNSIQRGRIARWPVRMGARGGA
 
Nucleotide Sequence: 1890 bp     [Download]
>gi|76817237|ref|NC_007435.1|:2075786-2077675 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGGACCCGCAATTGCTCGACTACTACAACCAGGAACTGATCTACATGCGCGAGCTCGGCGCCGAGTTCG
CGCGCGCGCACCCGAAGATTGCGCGGCGCCTCGGAATGCAGGCGGGCGAAGTGGCCGATCCGTACGTCGA
GCGGCTGATCGAATCGTTCTGCTTCATGGCCGCGCGCATGCAGATCAAGCTCGATGCGGAATTTCCGCGC
TTCACCGGCCGCCTGCTCGAGGTGCTCTATCCGACCTATGTCGCGCCGACGCCGTCGATGGCGGTCGCGC
GCCTGTACCCGAGCCGCACCGAAGGCAATCTCGCGCAAGGCTTTCGCGTCGCGCGCGGCACCGCGTTTGC
CGCGCGCGTGCCGGCCGGCGAGAAAACCGCGTGCCGGTTTCGCAGCGGCCAGGACGTGACGCTCTATCCG
CTCGAGATCGCCGACGCGCGGCTGACGGGGATTCCGCCGGACATCCCGGCGCTCGACCGCTACGTGCCGG
CCGGCGCGCAGGTGCGCGGCGCGCTGCGCCTGCGGCTGCGCACGACCGGCAACATGCGCATCGCCGATCT
GCGGGGCCTCGACCGGCTGCCGCTGTATCTCGCGGGCGACGCTCAGGTGGCCTCGCACCTGTTCGAGCTG
CTGCACGTGGCCGGCGTCGCGACGCTCACGGCCGCGCCCGGCGAGTTCGCCGCGCCGGGCCGCCCGCCCG
CGGCGGTTACCGTCGACGCGCTCGCTCACGAAGGGCTCGGCGCCGACGAGGGGCTGTTGCCGCTCACGTG
GGCGAAGTTCCATGGGCACAACCTGCTGCACGAATACTTCGCGTGCCCGGAGCGCTTCTATTTCGTCGCG
CTGACGGGGCTCGAGGAAGGGTTGCGGCGCATCGCGGGCAGCGAGGTCGAAATCGTCGTGCTGCTCGAAC
AATCGCCCGAGCGGCTCGCGGACGTCGTCGACGCGTCGCGCTTCGCGCTGTTCTGCACGCCGGTGATCAA
CCTGTTTCCGCGCCACATGGACCGGATCGAACTGTCGAGCGGGCAGACCGAATGCCATCTGGTGCCGGCC
CGCCTCGCGCCGCTCGACTACGAAGTATTTTCCGTCGAGGCGATGTACGGGCAGGTCGCCGCGACATCGG
CCGAACTCGAGTTCCGGCCGCTGTACCAGACGCTGAACGACGACGAGAGCAACTATGGACGCTATTTCTC
GACGCGGCGCGAGCGCCGGCTCGTGTCGGATTTCGCGCGCCGCTACGGCACGCGCACGCCGTACGTCGGC
ACGGAGATGTTCGTATCGCTCGTCGATCAGAACGAGGCGCCCTACAGCGAGGACATCCGCTATCTGTCGG
TGGACGCGCTGGTGACGAACCGCGACCTGCCGAGCCTCGTGCCGCGCGACGGCGTGCGCGACCTCACGGC
GATCGAATCCGCGCCGATCGACAGCGTCGGCCTGATCCGCGCGCCGTCCGCGCCGAAGGCGCCGTATGCG
GAGCGCGAGATCGCGTGGCGGCTGATCCGCCAGTTGAACTTCAACTATCTGCCGCTCGACGAGCTCGACC
ATCGCGCGGGCGGACAGGGCCTGCGCGGCCTGCTGCGGCTGTTTCTGGCGGGCGACGAGGCCGACAGCCG
GCGGCAGGTGGAAAGCCTTGTCGGCGTGAAGACGCGGCCCGTCACGCGCAAGCTGCCCGGCGCGGGCCCG
CTCGTGTTCGGGCGCGGCGTCGAGTGCGCGCTGAGCGTCGACGAAACGGGCTTCTCCGGCGTGAGCCCGT
ATCTGTTCGGGCTCGTGCTCGAGCATTATCTAGCGCGGCACGTGTCGATCAACGTGTTCACGCAGACCGA
GCTGAACTCGATCCAGCGCGGCCGCATCGCGCGCTGGCCGGTGCGCATGGGCGCGCGGGGAGGCGCGTGA