SecReT6
Protein ID: 76819652
SecReT6 ID93
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1196
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]1502781..1504652 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ3JJA0
KEGG IDbpm:BURPS1710b_A1196
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.00E-217, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|76819652|ref|YP_336353.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLAARVQLKMDAEFPR
FTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARPAAAEQTACEFRTAHDLTLWP
LELAGASVTGAPAYLPRSATAARRDVRGALRIRLKARGGAGLAQLPIDRLMFHLAGPERDALHLLELIAG
HTIGVVCHDAAQPPRWLHALGAHALAHQGFDADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRP
ALARATGDTFELTLLLDRHDAALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLD
YEVYAVRRLAGEQRDDGQMRAFRPFHASFAGDGGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAMIRGPSRPRPPLADAQSAW
RLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRVAFAPVFRRLPAAGPLMFGRG
VQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAECVLSSAQRGRLAQWPARVGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c1504652-1502781 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGATACGCGCCTGCTCGACTACTACAACCGCGAGCTCGCGTATCTGCGCGAGTTGGGCGGCGAGTTCG
CGCAGCAGTTTCCGAAAGTGGCCGCGCGCCTGCGGATGCACGAATCGGGGCCGCCCGATCCGTACGTCGA
GCGGCTGCTCGAAGGCTTCAGCTTTCTCGCCGCGCGCGTGCAACTGAAGATGGACGCGGAGTTTCCGCGC
TTCACGCAGGCGCTGCTCGACGCGGTGTATCCGGGTTACGTCGCGCCGCTTCCGTCGATGGCGATCGTGC
AGTTCACGCCGATGATGAACGAAGGCAGCCTCGCGCAGGGCTACCGGCTGCCGGCGGGCACCGCGCTGCG
CGCGCGGCCCGCCGCGGCCGAACAGACCGCGTGCGAGTTTCGCACCGCGCACGATCTGACGCTGTGGCCG
CTGGAGCTCGCGGGCGCTTCGGTGACGGGCGCGCCCGCGTATCTGCCGCGTTCGGCGACGGCCGCGCGCC
GCGACGTGCGCGGCGCGCTGCGCATCCGGCTGAAGGCGCGCGGCGGCGCGGGCCTCGCGCAACTGCCGAT
CGATCGGCTGATGTTCCACCTGGCGGGCCCCGAGCGCGACGCGCTGCATCTGCTCGAACTGATCGCCGGG
CATACGATCGGCGTCGTCTGCCACGACGCGGCGCAGCCGCCGCGCTGGTTGCACGCGCTCGGCGCGCACG
CGCTCGCGCATCAGGGCTTCGACGCCGATCAGGCGCTGCTGCCCGACGAAGGCCGCAGCTTCCACGGTTA
CCGGCTGCTGCGCGAGTACTTCGCGTTTCCCGCGCGCTTCCTGTTCTTCAGCATCGAAGGATTGCGGCCC
GCGCTCGCGCGCGCGACGGGCGACACGTTCGAGCTGACGCTGCTGCTCGATCGGCACGACGCGGCGCTCG
AGAACAGCGTCGATGCGCGGCACCTCGCGTTGAACTGCACGCCGGCCGTCAACCTGTTCGCGCGGCGCGC
GGACCGCATTCCGGTCCATCCGGGCGCGCGCGAGCATCATGTCGTCGTCGATCGCAGCCGGCCGCTCGAC
TACGAGGTCTACGCGGTGCGGCGGCTCGCGGGCGAGCAGCGCGACGACGGGCAGATGCGCGCGTTCCGGC
CGTTCCATGCGTCGTTCGCGGGCGACGGCGGCAATTACGGCGCGTACTACACGGTGCGCCGCGAGCCGCG
CCTCGTGTCCGCGCAGGCGCGCGCGAACGGCACGCGCACCGGCTACGTCGGCAGCGAGACGTTCGTGTCG
CTCGTCGATAGCGCGTGCGCGCCGTATGACGAATCGATCCGCTATCTGTCCGTCGACACGCTGTGCACGA
ACCGTGATCTCGTTCTGCTGTTGCCGGCGGGCGACGCGAACGCGTTCACGCTGCGCGTGTCGGCGCCCGT
CGAGCGGATCGCCATGATCCGCGGGCCGTCGCGGCCGCGCCCGCCGCTCGCCGACGCGCAGAGCGCGTGG
CGGCTCGTGAGCCATCTCGGGCTCGCGCGCCACACGCTGACCGATGTCGACGACGAAGAAGGCGCGCGCG
TGCTGCGCGAATTGCTCGGTCTGCACGCGGACCCGGCCGATGCGGCGATGCGCCGGCAGATCGACGGCGT
GCATCGTGTCGCGTTCGCGCCGGTGTTTCGCCGGCTGCCCGCCGCCGGGCCGCTGATGTTCGGGCGCGGC
GTGCAGGTGGACGTGACCGTCGACGATCATGCGTTCTCCGGCGACAGCCCCTATTTGCTCGGCGCGGTGC
TCGAGCAGTTTTTCGCGCGGCACGTGTCGATCAACTCGTTCGCCGAATGCGTGCTGAGCAGCGCGCAGCG
CGGCAGGCTCGCGCAATGGCCGGCGCGCGTCGGCAGGCGGCCCGCGATATGA