SecReT6
Protein ID: 76819777
SecReT6 ID95
T6SS typei3
Gene symbol-
Locus tagBURPS1710b_A1693
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]2067293..2067778 [-]
Producthypothetical protein
NoteTssD
UniProt IDQ3JHV3
KEGG IDbpm:BURPS1710b_A1693
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.40E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|76819777|ref|YP_336850.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLTFEHAIDRASPNLM
KYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIITRVRPSGSRDDTERSRETVSLSFAKVKQEYVVQN
AQGGSGGAVTTSFDIKGNKET
 
Nucleotide Sequence: 486 bp     [Download]
>gi|76817237|ref|NC_007435.1|:c2067778-2067293 Burkholderia pseudomallei 1710b chromosome II, complete sequence
ATGGCGCAGGATATTTTTCTGAAGATCGACGGCATCAACGGTGAATCCCTCGACGACAGCCACAAGGACG
AGATCGAAGTCCTGAACTGGAACTGGGAGATTCAGCAGGAATCGACGATGCACACGGGCAGCGGCGGCGG
CGCCGGCAAGGCGAGCGTGAAGGATCTGACGTTCGAGCACGCGATCGACCGCGCGAGCCCCAACCTGATG
AAGTACGCGCTGACCGGCAAGCACGTCGATCAGGCGGTGCTCGTGATGCGCAAGGCGGGCGGCAATCCGC
TCGAATACCTGAAGCTCACGATGAGCGACGTGATCATCACGCGCGTGCGGCCGTCGGGCAGCCGCGACGA
CACCGAGCGCAGCCGCGAGACGGTATCGCTGTCGTTCGCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCCGTCACGACGAGCTTCGACATCAAGGGCAACAAGGAAACCTGA