SecReT6
Protein ID: 76819789
SecReT6 ID92
T6SS typei1
Gene symbol-
Locus tagBURPS1710b_A0550
StrainBurkholderia pseudomallei 1710b
Repliconchromosome II [GenBank: NC_007435] [Browse all T6SS(s) in this replicon]
Location [Strand]744424..746364 [+]
Producthypothetical protein
NoteBMAA0729 (e)
UniProt IDQ3JL44
KEGG IDbpm:BURPS1710b_A0550
PDB IDNA
Domain hit(s) vs Pfam Big_5 [PF13205], Evalue: 1.00E-09, Aligned region: 348..447
UCH [PF00443], Evalue: 1.80E-07, Aligned region: 454..486
UCH [PF00443], Evalue: 1.80E-07, Aligned region: 595..627
Protein Sequence: 646 a.a.     [Download]
>gi|76819789|ref|YP_335709.1| unnamed protein product [Burkholderia pseudomallei 1710b]
MLDAARQRRRRRAVESSSHRVIESSSHRVIESSICRIHLRSLSIDVHLLSRNDESRFESRFGSSRSSQRA
AFDTKRRRLRRTVFDSCSRRRRCAAADSHGTPFRYAAISSTRTAPLAPQFTRGLPRRRAPLGIRRFSGRK
ERRPNAHRANRAVRESALAEARPRMNARRPAFGLIASHASRRRAVESVRAHFPFMFTLCLAMKHTSNHSD
PSGAPSSARRAASDSSRLVRGMRSPQRGGAALALAVASLAGCGGGDSGEPAPREFAPPTVQLAYPTQPNS
PVAPAPTAHVSSGHTPPATAPAAMPTASPTATPTASPTATPTASPTATAAASPSAPSTATPNAPPAAPPA
VVATRVPPTHAALRRPTIELEFDRAIEPGSVPHIVLRADDGTSVAVGPLSWLSDRRIAFAPRKPLKSNSR
YEIMVPAGIRSTTGERSAHPLTSSFDTAPVTPPRGLPNLDGASCFINTALQLAVHSSALDDILSNEAVPP
AVRTLLEDYDAASADALDAQLAAAVAALRATPEVPDSGPGQTLEVMQALRMPLYDTSSANNAKNNADAIR
HAPPNTKAFFLNSYPPLSYADLPNHDRLVAFDYSTGGHYVAYVKRDGIWYRIDDAQVSAVNEQDLLALPA
FNPANGSVSIEIAIYR
 
Nucleotide Sequence: 1941 bp     [Download]
>gi|76817237|ref|NC_007435.1|:744424-746364 Burkholderia pseudomallei 1710b chromosome II, complete sequence
GTGCTCGATGCGGCGCGGCAGCGGCGCCGTCGTCGGGCGGTCGAGTCATCGAGTCATCGAGTCATCGAGT
CATCGAGTCATCGAGTCATCGAGTCATCGATCTGTCGAATCCATTTACGTTCACTTTCCATTGATGTTCA
CCTTCTGTCTCGCAATGATGAATCACGCTTTGAATCACGCTTCGGATCAAGCCGATCGTCCCAACGCGCC
GCCTTCGACACGAAGCGCCGCCGGCTCCGACGCACCGTCTTCGACTCGTGCTCTCGACGACGCCGGTGCG
CTGCCGCCGACTCGCACGGCACGCCGTTCCGATACGCCGCCATCAGCTCGACACGCACCGCCCCACTCGC
CCCCCAGTTCACTCGGGGACTTCCGCGACGGCGCGCACCGCTCGGCATCCGGCGATTTTCCGGGCGCAAG
GAGCGACGCCCGAACGCACACCGCGCAAATCGAGCGGTTCGTGAAAGCGCCCTCGCCGAAGCGCGCCCGA
GAATGAACGCTCGACGTCCGGCGTTCGGCCTGATTGCGTCGCACGCGTCACGCCGCCGGGCCGTCGAATC
CGTGCGCGCCCACTTTCCGTTCATGTTCACCCTCTGTCTTGCGATGAAACACACTTCGAACCACTCCGAC
CCTTCCGGTGCGCCGTCGTCAGCGCGACGCGCCGCATCCGATTCGTCCCGCCTCGTCCGCGGCATGCGCT
CGCCCCAACGCGGCGGCGCGGCACTGGCGCTGGCCGTCGCCTCGCTCGCCGGATGCGGGGGCGGCGATTC
GGGCGAACCCGCTCCACGCGAATTCGCGCCCCCGACAGTGCAACTCGCCTACCCGACGCAACCGAACTCG
CCCGTCGCACCAGCGCCCACCGCGCACGTATCGAGCGGACACACGCCTCCGGCCACGGCGCCCGCCGCGA
TGCCCACCGCTTCCCCCACCGCGACGCCCACCGCTTCACCCACCGCGACGCCTACCGCTTCACCCACCGC
GACGGCTGCCGCTTCGCCCTCCGCGCCATCCACTGCGACGCCCAACGCCCCGCCCGCCGCTCCGCCGGCC
GTCGTCGCCACCCGCGTCCCGCCGACGCACGCGGCGTTGCGCCGCCCGACGATCGAACTCGAATTCGATC
GCGCGATCGAGCCGGGTTCAGTCCCACACATCGTGCTGCGCGCCGACGATGGCACGAGCGTCGCCGTCGG
CCCGTTGTCGTGGCTGAGCGATCGCCGGATCGCGTTCGCGCCGCGCAAACCGCTCAAGTCGAACAGCCGC
TACGAAATCATGGTGCCCGCCGGCATCAGGAGCACCACGGGCGAACGGTCGGCCCATCCGCTAACGAGCA
GCTTCGATACCGCGCCCGTTACGCCGCCGCGCGGCCTGCCCAATCTCGACGGCGCCTCGTGCTTCATCAA
CACGGCGCTGCAATTGGCGGTTCACTCGTCGGCGCTCGACGACATTCTGTCGAACGAAGCCGTCCCGCCC
GCCGTCCGCACGCTGCTCGAAGACTACGACGCCGCATCGGCTGACGCACTCGACGCGCAGTTGGCCGCCG
CGGTCGCCGCGCTGCGCGCCACGCCGGAGGTCCCGGACAGCGGGCCGGGACAAACGCTGGAAGTGATGCA
AGCGTTGCGGATGCCGTTATATGACACGAGCAGCGCGAACAACGCAAAGAACAACGCCGACGCCATACGT
CATGCGCCGCCCAACACCAAGGCGTTCTTTCTGAACTCCTATCCACCGCTTTCCTACGCGGATCTGCCGA
ACCACGACCGGCTCGTCGCGTTCGACTACAGCACGGGCGGTCACTATGTCGCTTATGTGAAGCGGGATGG
AATCTGGTATCGAATCGACGATGCCCAGGTCAGCGCCGTCAACGAACAGGACTTGCTTGCCCTGCCGGCG
TTCAACCCCGCTAACGGCAGCGTGTCGATCGAAATCGCGATCTATCGATGA