SecReT6
Protein ID: 77358729
SecReT6 ID68
T6SS typei3
Gene symbol-
Locus tagBMAA0403
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]395605..396183 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ4V2U8
KEGG IDbma:BMAA0403
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.40E-57, Aligned region: 15..166
Protein Sequence: 192 a.a.     [Download]
>gi|77358729|ref|YP_338343.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MTSKYKASASGQKFIARNRAPRVQIEYDVETYGAERKVQLSFVMGVIADLAGKRAEPLPDLPERKFLEID
VDNFDERMKSIAPRVAFQVPNTLSGDGMLSVDMTFESIDDFSPAAIARNVDALRRLLDARTELSNLLSYM
DGKHGAEQLIENAINDPALLASLVRQPLAADAEGGARQPVTGTEDDPEIRHE
 
Nucleotide Sequence: 579 bp     [Download]
>gi|77358719|ref|NC_006349.2|:395605-396183 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGACGAGCAAGTACAAGGCTTCGGCCAGCGGACAGAAATTCATCGCGCGCAACCGCGCGCCGCGCGTGC
AGATCGAGTACGACGTCGAGACCTACGGCGCCGAGCGCAAGGTCCAACTGTCGTTCGTGATGGGCGTGAT
CGCGGATCTCGCGGGCAAGCGGGCCGAGCCGCTGCCGGACTTGCCGGAGCGCAAGTTCCTCGAAATCGAC
GTCGACAATTTCGACGAGCGGATGAAATCGATCGCGCCGCGCGTCGCGTTCCAGGTGCCGAACACGCTGT
CGGGAGACGGCATGCTGAGCGTCGACATGACGTTCGAGAGCATCGACGATTTCTCGCCCGCCGCGATCGC
GCGCAACGTCGACGCGTTGCGGCGCCTGCTCGACGCGCGCACCGAGCTGTCGAACCTGCTGTCGTACATG
GACGGCAAGCACGGCGCCGAGCAACTGATCGAAAACGCGATCAACGATCCGGCACTGCTGGCCTCGCTCG
TGCGGCAGCCGCTCGCGGCGGACGCCGAAGGCGGCGCGCGGCAGCCCGTGACCGGCACCGAAGACGACCC
GGAGATTCGCCATGAATGA