SecReT6
Protein ID: 77358756
SecReT6 ID71
T6SS typei3
Gene symbol-
Locus tagBMAA1913
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]2096743..2098089 [+]
Producthypothetical protein
NoteTssK
UniProt IDQ4V2A3
KEGG IDbma:BMAA1913
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 2.20E-144, Aligned region: 20..447
Protein Sequence: 448 a.a.     [Download]
>gi|77358756|ref|YP_338538.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MSWHNKVVWSEGLFMRPQLFQQQERYLEHYAHKRAAPLSPFFFGFSHFSLDSEAPALGKIIVKSASGVFA
DGTPFDAPGSTPPPAPLTIRPEHLDQVIYLAVPIRVPNGEETAFDRAAESLARYAVFETDLRDTNSIGQG
PKTVQLSNLRLRLLPEKELTDAWIGLALTRVKTIRADASIELDDMLIPPVVGYGASDTLASWLAKIHDLT
RLRANALAERLTGSDGRASTTAEVSDYLLLQTLNRYEPLLKHLQRVPTTSPAELYALLIGMAGELSTYVR
TDTRRPLDTHPPYQHVAPHLCLKPVVDDTHRLLNAVLVRSAQRLALADLGHGMLNAVVDPVDMQGFTAVV
LAVHAQMPPDLLQQQFAAQAKAGPSERLPDLVRSHLSGIALQALPVPPRQIPFNAGYVYYELARGGPLWD
EVARHGGLALHIAGEFPSLKLELWGIRG
 
Nucleotide Sequence: 1347 bp     [Download]
>gi|77358719|ref|NC_006349.2|:2096743-2098089 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAGCTGGCATAACAAGGTCGTCTGGAGCGAGGGGCTTTTCATGCGCCCGCAGCTGTTCCAGCAGCAGG
AGCGCTATCTCGAGCACTACGCGCACAAGCGCGCGGCGCCGCTGTCGCCGTTCTTCTTCGGCTTCAGCCA
CTTCAGCCTCGACAGCGAGGCGCCGGCGCTCGGCAAGATCATCGTGAAATCGGCGAGCGGCGTGTTCGCC
GACGGCACGCCGTTCGACGCGCCGGGCAGCACGCCGCCGCCCGCGCCGCTCACGATCCGGCCCGAGCATC
TGGACCAGGTGATCTACCTCGCGGTGCCGATCCGCGTGCCGAACGGCGAGGAAACCGCATTCGACCGCGC
GGCCGAATCGCTCGCGCGCTATGCCGTGTTCGAAACCGACCTGCGCGACACGAACTCGATCGGGCAAGGG
CCGAAGACGGTCCAGTTGTCGAACCTGCGCCTGCGGCTGCTTCCGGAAAAGGAACTGACGGACGCGTGGA
TCGGGCTCGCGCTCACGCGCGTGAAGACGATTCGCGCGGACGCGAGCATCGAGCTCGACGACATGCTGAT
TCCGCCCGTGGTCGGCTACGGCGCGAGCGACACGCTCGCGAGCTGGCTCGCGAAGATCCACGATCTCACG
CGCCTGCGCGCGAACGCGCTCGCCGAGCGCCTGACGGGCTCGGACGGCCGGGCGAGCACGACGGCCGAAG
TATCCGACTACCTGCTGCTGCAAACGCTCAATCGCTACGAGCCGCTGCTGAAACACCTGCAGCGCGTGCC
CACGACGTCGCCCGCCGAGCTGTACGCGCTGCTCATCGGCATGGCGGGCGAGCTGTCCACCTACGTGCGC
ACCGATACGCGCCGGCCGCTCGATACGCACCCGCCCTATCAGCACGTCGCGCCGCATCTGTGCCTGAAGC
CCGTCGTCGACGACACGCACCGGCTGCTCAACGCCGTGCTCGTGCGCAGCGCGCAGCGCCTCGCGCTCGC
CGATCTGGGGCACGGAATGCTCAACGCGGTCGTCGATCCGGTCGACATGCAGGGCTTCACCGCGGTCGTG
CTCGCGGTGCATGCGCAGATGCCGCCCGATCTGCTGCAGCAGCAGTTCGCCGCGCAGGCGAAGGCGGGGC
CGTCCGAGCGGCTGCCGGACCTCGTGCGCAGCCATCTGTCCGGCATCGCGCTGCAGGCGCTGCCGGTGCC
GCCCCGACAGATCCCGTTCAACGCCGGCTACGTCTATTACGAGCTCGCGCGCGGCGGGCCGCTGTGGGAC
GAAGTCGCGCGGCACGGCGGGCTCGCGCTGCACATCGCCGGCGAATTTCCGTCGCTGAAGCTCGAGCTAT
GGGGCATTCGCGGATAG