SecReT6
Protein ID: 77358758
SecReT6 ID71
T6SS typei3
Gene symbol-
Locus tagBMAA1911
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]2095626..2096111 [+]
Producthypothetical protein
NoteTssD
UniProt IDQ4V2A5
KEGG IDbma:BMAA1911
PDB IDNA
Domain hit(s) vs Pfam DUF796 [PF05638], Evalue: 8.40E-44, Aligned region: 6..136
Protein Sequence: 161 a.a.     [Download]
>gi|77358758|ref|YP_338536.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MAQDIFLKIDGINGESLDDSHKDEIEVLNWNWEIQQESTMHTGSGGGAGKASVKDLTFEHAIDRASPNLM
KYALTGKHVDQAVLVMRKAGGNPLEYLKLTMSDVIITRVRPSGSRDDTERSRETVSLSFAKVKQEYVVQN
AQGGSGGAVTTSFDIKGNKEA
 
Nucleotide Sequence: 486 bp     [Download]
>gi|77358719|ref|NC_006349.2|:2095626-2096111 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGGCGCAGGATATTTTTCTGAAGATCGACGGCATCAACGGTGAATCCCTCGACGACAGCCACAAGGACG
AGATCGAAGTCCTGAACTGGAACTGGGAGATTCAGCAGGAATCGACGATGCACACGGGCAGCGGCGGCGG
CGCCGGCAAGGCGAGCGTGAAGGATCTGACGTTCGAGCACGCGATCGACCGCGCGAGCCCCAACCTGATG
AAGTACGCGCTGACCGGCAAGCACGTCGATCAGGCGGTGCTCGTGATGCGCAAGGCGGGCGGCAATCCGC
TCGAATACCTGAAGCTCACGATGAGCGACGTGATCATCACGCGCGTGCGGCCGTCGGGCAGCCGCGACGA
CACCGAGCGCAGCCGCGAGACGGTATCGCTGTCGTTCGCGAAGGTGAAGCAGGAGTATGTCGTGCAGAAC
GCGCAGGGCGGCAGCGGCGGCGCCGTCACGACGAGCTTCGACATCAAGGGCAACAAGGAAGCCTGA