SecReT6
Protein ID: 77358759
SecReT6 ID71
T6SS typei3
Gene symbol-
Locus tagBMAA1910
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]2094010..2095509 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ4V2A6
KEGG IDbma:BMAA1910
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.30E-191, Aligned region: 67..493
Protein Sequence: 499 a.a.     [Download]
>gi|77358759|ref|YP_338535.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MKKQQAQTAAAGVQPQADSDFAQLLAQEFKPKTEQAREAVEYAVRTLAEQALAQSATISDDAYKSIAAII
AQIDHKLSEQINLILHHADFQKLESAWRGLHHLVSNTETDERLKIRFMDISKEELRRTMRRYKGQSWDQS
PLFKQIYEEEYGQLGGEPYGCLVADYYFDHTPPDVDLLGSISKVAASAHTPFLSGASPSVLQMESWQELA
NPRDLTKIFTQNLEYASWNALRNMDDARYIGLAMPRFLSRLPYGVLTNPVDEFDFEEDTNGADHRRYAWT
NAAYAMGVNINRSFRLYGWCSLIRGVESGGTVENLPCHTFPTDDGGIDIKCPTEIAISDRREAELSKNGF
IPLVHRKNTDHATFIGAQSLHKPAEYDDSDATANANLSARLPYLFACSRFAHYLKCIVRDKVGAFKERED
MQRWLNEWIMNYVDADPANSSQDTKARRPLAAAEVVVEQAQGNPGYYQAKFFLRPHFQLEGLTVSLRLVA
KLPSIKEAA
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|77358719|ref|NC_006349.2|:2094010-2095509 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAAGAAACAGCAAGCCCAGACGGCCGCCGCCGGCGTCCAGCCGCAAGCGGATTCGGATTTCGCGCAGT
TGCTCGCGCAGGAGTTCAAGCCGAAGACGGAGCAGGCGCGCGAAGCGGTCGAATACGCGGTGCGCACGCT
CGCCGAGCAGGCGCTCGCGCAATCGGCGACGATCAGCGACGATGCATACAAGAGCATCGCCGCGATCATC
GCGCAGATCGACCATAAGCTATCCGAACAGATCAACCTGATCCTCCATCACGCGGATTTCCAGAAGCTCG
AATCGGCGTGGCGCGGGCTGCATCACCTGGTGTCGAACACCGAGACCGACGAGCGCCTGAAGATCCGCTT
CATGGACATCTCGAAGGAAGAGCTGCGCCGCACGATGCGGCGCTACAAGGGGCAATCGTGGGACCAGAGC
CCGCTCTTCAAGCAGATCTACGAGGAGGAGTACGGGCAGCTCGGCGGCGAGCCGTACGGCTGCCTCGTCG
CCGATTACTACTTCGACCACACGCCGCCCGACGTCGACCTGCTCGGCTCGATCTCGAAGGTGGCCGCGTC
CGCGCACACGCCGTTCCTCTCCGGCGCGTCGCCTTCGGTGCTGCAGATGGAATCGTGGCAGGAGCTCGCG
AACCCGCGCGACCTGACGAAGATCTTCACGCAAAACCTCGAATACGCGTCATGGAACGCGCTGCGCAACA
TGGACGACGCGCGCTACATCGGCCTCGCGATGCCGCGCTTCCTGTCGCGCCTGCCGTACGGCGTGCTGAC
GAATCCCGTCGACGAGTTCGACTTCGAGGAAGACACGAACGGCGCCGACCATCGCCGCTATGCGTGGACG
AACGCCGCCTACGCGATGGGCGTGAACATCAACCGGTCGTTCCGGCTCTACGGCTGGTGCTCGCTCATTC
GCGGCGTCGAATCGGGCGGCACGGTCGAGAACCTGCCGTGCCATACGTTCCCGACCGACGACGGCGGCAT
CGACATCAAATGCCCAACCGAGATCGCGATCTCGGACCGGCGCGAGGCGGAGCTGTCGAAGAACGGCTTC
ATTCCGCTCGTGCACCGCAAGAACACCGATCACGCGACGTTCATCGGCGCGCAATCGCTGCACAAGCCGG
CCGAATACGACGATTCCGACGCGACGGCCAACGCGAACCTGTCGGCGCGCCTGCCGTATCTGTTCGCATG
CTCGCGCTTCGCGCACTACCTGAAGTGCATCGTGCGCGACAAGGTGGGCGCCTTCAAGGAGCGCGAGGAC
ATGCAGCGCTGGCTGAACGAATGGATCATGAACTACGTCGACGCGGACCCGGCGAACTCGTCGCAGGACA
CGAAGGCGCGCCGGCCGCTCGCGGCCGCCGAGGTGGTCGTCGAGCAGGCGCAGGGCAACCCCGGCTACTA
CCAGGCGAAGTTCTTCCTGCGGCCGCATTTCCAGCTCGAGGGCCTGACCGTGTCGCTGCGGCTCGTCGCG
AAGCTGCCGTCGATCAAGGAAGCCGCCTGA