SecReT6
Protein ID: 77358763
SecReT6 ID71
T6SS typei3
Gene symbol-
Locus tagBMAA1906
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]2088221..2089186 [-]
Producthypothetical protein
NoteTagJ
UniProt IDQ4V2A7
KEGG IDbma:BMAA1906
PDB IDNA
Domain hit(s) vs Pfam ImpE [PF07024], Evalue: 4.60E-51, Aligned region: 149..294
Protein Sequence: 321 a.a.     [Download]
>gi|77358763|ref|YP_338534.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MTTPAFPAPPGARTSARPHDTPLDARLAAAQAAVRARPVDAASRWALFQLLCVTGQGERAVGQLQAYARF
AAQHAHIAHAYRDLIRAERFHARVMAGQARPGFVFDAPPWIDDLLEALRAQAAGARDEADRARSRALDRA
PFVAGRGPDAPFDWIADSDSRFGPVCEVVTAGHDRWLPFSDLAGWRLARPGVLLALVWAPCVLTLADGSV
AHGFMPARYPGSELADGGGAPGASAAAHEADAHESAAREADALRLGSRTAWRDVGRTGVFALGRKTWSTS
AGDAGLFELHACEFGARARAGAVLGGAAREARGGEAADGCA
 
Nucleotide Sequence: 966 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c2089186-2088221 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGACGACGCCTGCCTTCCCGGCGCCGCCCGGCGCACGCACGTCGGCCCGGCCGCACGATACGCCGCTCG
ACGCGCGGCTCGCGGCTGCGCAAGCCGCGGTGCGCGCCCGGCCCGTCGATGCGGCGAGCCGTTGGGCGCT
GTTTCAACTGCTCTGCGTGACGGGCCAGGGGGAACGCGCCGTCGGGCAGTTGCAGGCTTATGCGCGGTTC
GCCGCGCAGCACGCGCACATCGCGCACGCCTATCGCGACCTGATTCGCGCCGAGCGCTTTCACGCCCGCG
TGATGGCGGGCCAGGCGCGGCCGGGATTCGTATTCGATGCGCCGCCGTGGATCGACGATCTGCTGGAAGC
GTTGCGCGCGCAGGCGGCCGGCGCGCGCGACGAAGCCGACCGCGCGCGTTCGCGCGCGCTCGATCGCGCG
CCGTTCGTCGCGGGGCGCGGGCCGGATGCGCCGTTCGACTGGATCGCCGACAGCGATTCGCGATTCGGGC
CGGTCTGCGAAGTCGTGACCGCCGGGCATGATCGTTGGCTGCCGTTTTCGGATCTGGCCGGATGGCGGCT
CGCGCGCCCGGGCGTGCTGCTCGCTCTGGTCTGGGCGCCGTGCGTGCTCACGCTTGCCGACGGCAGTGTC
GCGCACGGCTTCATGCCAGCGCGTTACCCGGGCTCCGAACTGGCCGACGGGGGCGGCGCGCCGGGCGCCT
CAGCGGCCGCGCACGAGGCCGATGCGCACGAGAGCGCCGCGCGCGAGGCCGATGCGTTGCGGCTCGGCAG
CCGGACCGCATGGCGCGACGTCGGCCGCACCGGCGTGTTCGCGCTCGGCCGCAAGACCTGGTCGACGAGC
GCGGGCGACGCCGGCCTTTTCGAGCTGCACGCGTGTGAATTCGGCGCGCGCGCCCGTGCGGGCGCCGTGC
TCGGCGGCGCGGCGCGCGAAGCGCGCGGCGGGGAGGCGGCCGATGGATGCGCATGA