SecReT6
Protein ID: 77358799
SecReT6 ID70
T6SS typei1
Gene symbol-
Locus tagBMAA0732
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]743397..744794 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ4V2Q3
KEGG IDbma:BMAA0732
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 1.50E-98, Aligned region: 16..462
Protein Sequence: 465 a.a.     [Download]
>gi|77358799|ref|YP_338388.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MDNVYWHQGMLLQPQHFQLAELHQQFRFEPWLACGPPHFWGVGALSLAQAAIDRRVVEIRSARLLFADRS
YVEYPGNAVVAARAFDPAWLDEGRALVAHVALRRLARGANNVTVAAAPDALPDAPTRYATLPSAEEVADL
HSDHPGAPVRTLKHVLKIVFEHELDALAAHETIPIARIVRDGERLRLDDDFAPPCYALSGSRTLLERVRC
IRDELAGRARQLQQYKNPREMQRAEFDASYAAFLLALRSLNRFGPLLFHLAECDGQHPWTVYGVLRQLVG
ELSVFSECFDMLGETPDARGGLPPYDHRDLGGCFSRAHALIGHLLDEIAVGPDCVATFEPDGPQQPAQRS
AQLPPDVFADRHQIYLAIRSAHDPDTLAQRFALGGRIAATDEMPQLTALALPGVELTRLPGPPPRLPRRG
DARYFRIEQAGRPWDAIRRDGRVSLRWADAPDDLHAELVAVRHTQ
 
Nucleotide Sequence: 1398 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c744794-743397 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGGACAACGTCTATTGGCATCAGGGGATGCTGCTGCAACCGCAACATTTTCAGTTGGCCGAACTGCACC
AGCAGTTCCGCTTCGAGCCGTGGCTCGCGTGCGGCCCGCCGCATTTCTGGGGCGTCGGCGCGCTGTCGCT
CGCGCAGGCCGCGATCGATCGCCGCGTGGTCGAGATCCGCTCGGCGCGCCTGCTGTTCGCCGACCGCAGC
TACGTCGAATATCCGGGCAACGCGGTCGTCGCCGCGCGCGCGTTCGATCCCGCGTGGCTCGACGAAGGCC
GCGCGCTCGTCGCGCACGTCGCGCTCAGGCGGCTCGCGCGCGGCGCGAACAACGTGACGGTCGCGGCCGC
GCCCGACGCGTTGCCCGACGCCCCGACGCGCTACGCGACGCTGCCGTCCGCCGAGGAGGTCGCCGATCTG
CATTCGGACCATCCGGGCGCGCCGGTGCGCACGCTCAAGCACGTGCTGAAGATCGTGTTCGAGCACGAGC
TCGACGCGCTCGCCGCGCACGAAACGATCCCGATCGCGCGGATCGTGCGCGACGGCGAGCGCCTGCGGCT
CGACGACGATTTCGCGCCGCCCTGCTACGCGCTGTCGGGCTCGCGCACGCTGCTCGAGCGCGTGCGCTGC
ATTCGCGACGAGCTCGCGGGCCGCGCGCGGCAGTTGCAGCAGTACAAGAATCCGCGCGAGATGCAACGCG
CCGAATTCGACGCGAGCTATGCGGCGTTCCTGCTCGCGCTGCGCTCGCTGAACCGCTTCGGCCCGCTGCT
GTTCCATCTCGCCGAATGCGACGGGCAGCATCCATGGACGGTCTACGGCGTGCTGCGCCAACTCGTCGGC
GAGCTGAGCGTGTTCTCCGAGTGCTTCGACATGCTCGGCGAGACGCCCGATGCGCGCGGCGGCCTGCCGC
CGTACGACCACCGCGATCTGGGCGGCTGCTTCTCGCGCGCGCACGCGCTGATCGGCCACCTGCTCGACGA
AATCGCGGTGGGCCCGGACTGCGTCGCGACGTTCGAGCCCGACGGCCCGCAGCAGCCCGCGCAACGCTCG
GCGCAACTGCCGCCCGACGTGTTCGCGGATCGCCACCAGATCTATCTCGCGATCCGCAGCGCGCACGATC
CGGACACGCTCGCGCAACGCTTCGCGCTCGGCGGCCGGATCGCGGCGACCGACGAAATGCCGCAGCTCAC
CGCGCTCGCGCTGCCGGGCGTCGAACTCACCCGCCTGCCCGGCCCGCCGCCGCGGCTGCCGCGCCGCGGC
GACGCGCGCTACTTCCGGATCGAGCAGGCCGGCCGCCCGTGGGACGCGATCCGGCGTGACGGCCGCGTGT
CGCTGCGCTGGGCCGACGCGCCCGACGACCTGCACGCGGAACTCGTCGCAGTGAGGCACACGCAATGA