SecReT6
Protein ID: 77358915
SecReT6 ID69
T6SS typei3
Gene symbol-
Locus tagBMAA0446
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]445391..447679 [+]
ProductRhs element Vgr protein
NoteTssI
UniProt IDQ4V2T5
KEGG IDbma:BMAA0446
PDB IDNA
Domain hit(s) vs Pfam Phage_GPD [PF05954], Evalue: 2.10E-70, Aligned region: 23..327
Phage_base_V [PF04717], Evalue: 3.60E-22, Aligned region: 365..458
Protein Sequence: 762 a.a.     [Download]
>gi|77358915|ref|YP_338356.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MRLIELRSPLLDPDAVALSFVVHENLSQEPSYQLDLLSHDSNLDFDALLGSTLSADIDLGEGDIRTFNTH
VFGGYDTGQMSGQYTYTLELRSWLSFLAENRNSRIFQDLSVPQIVEQVFQGHQRNGYRFELEGTYEPREY
CVQFQETDLNFVKRLLEDEGIYFWVEHEPDRHVVVISDTQRFEDLPLPNDTLEYLPDGEESRAIQGREGV
QRLQRTRRIKSNNVALRDFDYHAPSKQLDSDAQVEQQSLGGIPLEYYDYAAGYRDPEQGERLARLRLEAI
QADAHALGGEANARALAVGRAFTLVGHPALSRNRRYYVTNSELTFIQDGPDSTSQGRNVAVKFRALADDQ
PFRPLLVTKRPRVPGIQSATVVGPEMSEVHTDKLGRIRVHFHWDRYKTTEADASCWIRVTQAWAGKGWGV
LAMPRVGQEVIVVYVDGDLDRPLATGIVYNGENPTPYDLPKDIRYTGLVTRSIKRAGGIPNASQLTFDDQ
HGAERVMIHAERDLQQTVERNSSTSIAQDLNLSVKGTSTSVVGISVSFTGISVSYTGLSVSFTGVSARFT
GVSTSFTGVSTSFTGVSTSFTGVDTSFTGVSTGFKGVDTSFTGVATSMVGVSTSITGSSNSVTGVSNSMT
GISSSWKDVSMSTTGQSESITGVSLSYTGTSNSMTGTSTSVTGTSTSITGTSMSNTGSSTSITGTSMSTT
GSSVSTTGSSMSATGSSVGTTGSSVSTTGSKMSVTGFSFSYTGASYEDVGVDLKKLGMQTKN
 
Nucleotide Sequence: 2289 bp     [Download]
>gi|77358719|ref|NC_006349.2|:445391-447679 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGCGTCTGATCGAACTGCGCAGTCCCCTGCTGGACCCGGACGCCGTCGCGCTGAGCTTCGTGGTGCATG
AGAACCTGTCGCAGGAGCCGTCGTATCAGCTCGATCTGCTGAGCCACGATTCGAATCTGGACTTCGACGC
GCTGCTCGGCTCGACGCTGTCGGCCGACATCGACCTGGGCGAAGGCGACATCCGGACGTTCAACACGCAC
GTGTTCGGCGGCTACGACACGGGGCAGATGAGCGGGCAATACACGTACACGCTGGAGCTGCGAAGCTGGT
TGTCGTTTCTCGCGGAGAACCGCAACAGCCGGATCTTCCAGGATTTGAGCGTGCCGCAGATCGTCGAGCA
GGTGTTCCAGGGCCATCAGCGCAACGGCTACCGGTTCGAGCTCGAAGGCACGTACGAGCCGCGCGAGTAC
TGCGTGCAGTTTCAGGAAACGGATCTGAACTTCGTGAAGCGGCTGCTGGAGGACGAAGGGATCTACTTCT
GGGTGGAGCACGAGCCGGACCGTCATGTGGTGGTGATCTCGGACACGCAGCGGTTCGAGGATCTGCCGCT
GCCGAACGACACGCTGGAGTATTTGCCGGACGGCGAGGAGTCGCGCGCGATCCAGGGGCGCGAAGGGGTG
CAGCGGCTGCAGCGCACGCGGCGGATCAAGTCGAACAACGTCGCGCTGCGGGATTTCGACTATCACGCGC
CGTCGAAGCAACTGGACAGCGACGCGCAGGTCGAGCAACAGAGCCTCGGCGGCATTCCGCTCGAGTACTA
CGACTACGCGGCCGGCTACCGCGACCCCGAGCAGGGCGAGCGCCTCGCGCGGCTGCGGCTCGAAGCGATT
CAGGCTGATGCACACGCGCTCGGGGGCGAGGCGAACGCACGCGCGCTGGCGGTGGGTCGCGCGTTCACGC
TGGTCGGCCATCCGGCGCTGAGCCGCAATCGTCGGTACTACGTGACGAACAGCGAGCTGACGTTCATCCA
GGACGGACCGGACAGCACGTCGCAGGGGCGCAACGTCGCGGTGAAGTTCCGCGCGCTCGCCGACGATCAG
CCGTTTCGGCCGCTGCTTGTCACCAAGCGGCCGCGCGTGCCGGGCATCCAGAGCGCGACGGTGGTGGGCC
CGGAGATGTCGGAGGTGCATACCGACAAGCTCGGGCGGATTCGCGTGCACTTCCACTGGGACCGCTACAA
GACGACCGAGGCGGACGCGTCGTGCTGGATTCGCGTGACGCAGGCATGGGCGGGCAAGGGCTGGGGCGTG
CTCGCGATGCCGCGGGTCGGGCAGGAAGTCATCGTCGTGTATGTCGACGGCGATCTCGACCGGCCGCTCG
CGACGGGCATCGTCTACAACGGCGAAAACCCGACGCCTTATGACCTGCCGAAGGATATCCGCTACACGGG
CCTCGTCACACGCTCGATCAAGCGGGCGGGCGGCATTCCGAATGCGAGCCAACTGACGTTCGACGATCAG
CACGGCGCGGAGCGCGTGATGATCCACGCGGAGCGCGACTTGCAGCAGACGGTCGAGCGCAACAGCTCGA
CGTCGATCGCGCAGGATCTGAACCTGTCGGTGAAGGGCACGTCGACGTCGGTCGTCGGCATCTCGGTCAG
CTTCACGGGCATCTCGGTGTCGTACACGGGGTTGTCGGTGAGCTTCACCGGCGTGTCGGCGAGGTTCACG
GGCGTGAGCACGTCGTTTACCGGCGTGAGCACGAGTTTCACCGGCGTGTCGACGTCGTTTACCGGCGTCG
ATACCAGCTTCACTGGCGTCTCGACCGGATTCAAGGGCGTCGACACGAGCTTCACCGGCGTCGCGACGTC
GATGGTGGGCGTGTCGACGAGCATCACGGGCTCCAGCAATTCCGTGACGGGCGTGTCGAACAGCATGACG
GGCATCTCGTCTTCCTGGAAGGACGTGAGCATGTCGACGACCGGCCAGTCCGAAAGCATCACGGGAGTAT
CGCTGTCGTACACGGGCACGTCGAACAGCATGACGGGCACGAGCACGTCGGTGACGGGCACCTCGACGAG
CATCACCGGCACGTCGATGTCGAACACCGGCAGCTCGACGAGCATCACGGGCACATCGATGTCGACGACG
GGCAGCTCGGTGAGCACGACGGGCTCGAGCATGTCGGCCACCGGCAGTTCGGTGGGCACGACGGGCTCGA
GCGTATCGACGACGGGAAGCAAGATGTCGGTCACCGGCTTCAGCTTCTCGTATACGGGAGCGAGCTACGA
GGATGTGGGCGTCGATCTGAAAAAGCTCGGGATGCAGACGAAGAACTGA