SecReT6
Protein ID: 77358917
SecReT6 ID69
T6SS typei3
Gene symbol-
Locus tagBMAA0443
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]439126..440115 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ4V2T6
KEGG IDbma:BMAA0443
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 1.30E-58, Aligned region: 13..312
Protein Sequence: 329 a.a.     [Download]
>gi|77358917|ref|YP_338355.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MTPLERVSRALTPRRTFFELMRRVEALQRRHDGRSARKRRMPKWLRIEQPAQMHFASTEVERVQVTLARF
VEDDDHPQVTVAQRHFGLFAPYGPLPLHVTEHAMQEKRFERNAAFERFVNVACGDLAWLHYSAWSSMHPV
LGYERARNPFVERVTALADACRAQQDDGEPYGRHALACRRAFPGIYCAPRRSLADLQRLLRAYFGVALQV
VPRHGRWVPVPAAASHARRLGGWRLGARIWDVQHSIEIVVGPIEADEFYRWQRRAAAVMALSAVVTDFVD
GRIYPVIKVQVWTRPELAGRVGCMRVGVDAWSRPNRALRTLTVFESFRD
 
Nucleotide Sequence: 990 bp     [Download]
>gi|77358719|ref|NC_006349.2|:439126-440115 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGACGCCGCTCGAGCGCGTGAGCCGGGCGCTGACGCCGCGCCGCACGTTCTTCGAGCTGATGCGGCGCG
TCGAGGCGCTGCAGCGCAGGCACGACGGGCGTTCGGCGCGCAAGCGCCGGATGCCGAAGTGGCTGCGCAT
CGAGCAGCCGGCGCAGATGCACTTCGCGAGCACGGAAGTCGAGCGCGTGCAGGTGACGCTCGCGCGCTTC
GTCGAGGACGACGATCACCCGCAGGTCACGGTGGCGCAGCGCCATTTCGGGCTGTTCGCGCCGTACGGGC
CGCTGCCGCTGCACGTGACCGAGCACGCGATGCAGGAGAAGCGCTTCGAGCGCAACGCCGCGTTCGAGCG
CTTCGTAAACGTCGCGTGCGGCGATCTCGCGTGGCTGCATTACTCGGCGTGGTCGTCGATGCATCCGGTG
CTCGGCTACGAGCGCGCGCGCAATCCGTTCGTCGAGCGCGTGACGGCGCTCGCCGATGCGTGCCGCGCGC
AGCAGGACGACGGCGAGCCGTACGGGCGGCACGCGCTCGCATGCCGGCGCGCGTTTCCGGGCATCTACTG
CGCGCCGCGCCGCTCGCTGGCCGATCTGCAGCGGCTGCTGCGCGCGTACTTCGGCGTGGCGCTGCAGGTC
GTGCCGCGCCACGGGCGCTGGGTGCCGGTGCCGGCCGCGGCGAGCCATGCGCGGCGGCTCGGCGGCTGGC
GGCTGGGCGCGCGGATCTGGGACGTGCAGCACTCGATCGAGATCGTGGTGGGGCCGATCGAGGCGGACGA
GTTCTACCGGTGGCAACGCCGCGCGGCCGCCGTGATGGCGCTGTCGGCGGTCGTGACGGATTTCGTCGAC
GGACGGATTTACCCCGTCATCAAGGTTCAGGTGTGGACGCGCCCTGAACTCGCAGGAAGGGTTGGGTGCA
TGCGTGTCGGGGTCGACGCGTGGTCACGGCCGAATCGGGCGCTGCGCACCTTGACTGTCTTTGAATCTTT
TCGGGACTAG