SecReT6
Protein ID: 77358918
SecReT6 ID69
T6SS typei3
Gene symbol-
Locus tagBMAA0442
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]437267..439129 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ4V2T7
KEGG IDbma:BMAA0442
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 2.60E-127, Aligned region: 3..605
Protein Sequence: 620 a.a.     [Download]
>gi|77358918|ref|YP_338354.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MNFLDHYNDELRQLRDAGARFSKEHPQVASALGLHPDAVTDPFVERLLEGVAYLSARVQKRLDRECAEFA
QQALGRICPLYTASTPAISTFAFHPDLGSPDAFRGNTLPRGSLIAAHLPGRKLPVMFSTAREVTLLPLRL
ASVECSRSITGLPSLLAQRLASSHAVLRFRFEIEGGASIAELAREDDGFKPLHLSVAGDLPRAYALHRAL
LADTTAWYALVSTNRGDEVLPLPMSGIRLSGVDDEEALLPEAFGGLPGLRLLREYFAQPTRLLGVYVDAL
AAIAAKAPSARAFDLFFALRDAPGDLVGDVDASQFRLFATPAINLYSKRFDPVPYDANQPEQWIPVDRMR
PAAHHLWALTEVFVCETNGRAHRARSVLETAGYEGHEGSIRYGMRREDALLVDGVRRDRFDPLASHDLIA
VSMVDDTLEPDDVATITGRALVADRDWRPSALLDAELQLLDPTAVKRIECLWPASAPRGKPSIDACWEAV
SHVGRNPLALRASQQQDVTARIVEQLLLAIDKDDALDRQRLESLRSVVLRSRFVAAGRATPTALVRATQV
EIDIAESLHADRGGWLFGRLLAQALAEAATLNDGIEIVVRLDGEAASTHTNVATRDGRLA
 
Nucleotide Sequence: 1863 bp     [Download]
>gi|77358719|ref|NC_006349.2|:437267-439129 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAACTTCCTCGATCACTACAACGACGAATTGCGCCAGTTGCGCGATGCGGGCGCACGCTTCTCCAAGG
AGCACCCGCAGGTGGCCTCCGCGCTCGGGCTGCATCCGGATGCGGTCACCGATCCGTTCGTCGAGCGCCT
GCTCGAGGGCGTCGCGTACCTGTCGGCGCGCGTGCAGAAGCGGCTCGATCGCGAGTGCGCGGAGTTCGCG
CAGCAGGCGCTCGGGCGCATCTGCCCGCTCTACACGGCTTCGACGCCCGCGATCTCGACGTTCGCGTTCC
ATCCCGATCTCGGCTCGCCCGATGCGTTTCGCGGCAACACGCTGCCGCGCGGCTCGCTCATCGCCGCGCA
CCTGCCCGGGCGCAAGCTGCCGGTGATGTTCTCGACCGCGCGCGAGGTCACGCTGCTGCCGCTGCGTCTC
GCATCGGTCGAGTGCAGCCGCAGCATCACCGGGCTGCCGTCGCTGCTCGCGCAGCGGCTCGCCTCGTCGC
ACGCGGTGCTGCGCTTCAGGTTCGAGATCGAGGGCGGCGCGTCGATCGCGGAGCTCGCGCGCGAGGACGA
CGGCTTCAAGCCGCTGCATCTGAGCGTGGCGGGCGATCTGCCGCGCGCATATGCGCTGCACCGCGCGCTG
CTCGCCGACACCACCGCGTGGTACGCGCTCGTGTCGACGAACCGCGGTGACGAGGTGCTGCCGTTGCCGA
TGTCGGGCATCCGGCTGTCCGGCGTCGACGACGAGGAGGCGCTGCTGCCCGAGGCGTTCGGCGGGCTGCC
CGGCCTGCGGCTGCTGCGCGAGTACTTCGCGCAGCCCACGCGGCTGCTCGGCGTCTACGTCGACGCGCTG
GCGGCGATCGCCGCGAAGGCACCGTCCGCGCGCGCGTTCGATCTGTTCTTCGCGTTGCGCGACGCGCCGG
GCGATCTGGTGGGCGACGTCGACGCGAGCCAGTTCCGCCTGTTCGCGACGCCGGCGATCAATCTGTATTC
CAAACGTTTCGACCCGGTGCCGTACGACGCGAATCAGCCCGAGCAGTGGATTCCCGTCGACCGGATGCGG
CCCGCCGCGCATCACCTGTGGGCGCTCACCGAGGTGTTCGTGTGCGAGACCAACGGTCGCGCGCACCGCG
CGCGCTCGGTGCTCGAGACGGCGGGCTACGAAGGGCACGAAGGCTCGATCCGCTACGGCATGCGGCGCGA
GGACGCGCTGCTCGTCGACGGCGTGCGGCGCGACCGGTTCGATCCGCTCGCGAGCCACGACCTGATCGCC
GTCTCGATGGTCGACGACACGCTCGAGCCGGACGACGTCGCGACGATCACGGGCCGCGCGCTCGTGGCCG
ATCGCGACTGGCGCCCGAGCGCTCTGCTCGACGCCGAGCTGCAACTGCTCGATCCGACCGCGGTCAAGCG
CATCGAGTGCCTGTGGCCGGCGAGCGCGCCGCGCGGCAAGCCGAGCATCGACGCGTGCTGGGAGGCGGTC
TCGCACGTCGGGCGCAACCCGCTCGCGCTGCGCGCGTCGCAGCAGCAGGACGTGACGGCGCGCATCGTCG
AGCAGTTGCTGCTCGCGATCGACAAGGACGACGCGCTCGATCGCCAGCGGCTCGAGAGCCTGCGCTCGGT
CGTGCTGCGCTCGCGCTTCGTCGCGGCGGGGCGCGCCACGCCCACCGCGCTGGTGCGCGCGACACAGGTG
GAGATCGACATCGCCGAATCGCTGCACGCCGATCGCGGCGGCTGGCTGTTCGGGCGGCTGCTCGCGCAGG
CGCTCGCGGAGGCCGCCACGCTCAACGACGGCATCGAGATCGTGGTGCGCCTGGACGGCGAAGCGGCGAG
CACGCACACGAACGTCGCCACGCGAGACGGGAGGCTCGCATGA