SecReT6
Protein ID: 77358923
SecReT6 ID69
T6SS typei3
Gene symbol-
Locus tagBMAA0438
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]434138..434563 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ4V2U0
KEGG IDbma:BMAA0438
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 8.20E-38, Aligned region: 1..118
Protein Sequence: 141 a.a.     [Download]
>gi|77358923|ref|YP_338351.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MMADLSGDNVEPLGPVEDRRFQEIDVENFDERMAQIAPSLSYHVKNVLTNDGTLIPIDLTFTSMESFEPA
DVVKRIPELSTLLEARNRLKELLTYMDGKAAAEDVIQELLKSPQWANEADAAEQSGGAGEGGDHQPEEGA
K
 
Nucleotide Sequence: 426 bp     [Download]
>gi|77358719|ref|NC_006349.2|:434138-434563 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
GTGATGGCGGACCTGTCGGGCGACAACGTCGAGCCGCTCGGCCCGGTCGAGGATCGGCGCTTTCAGGAGA
TCGACGTCGAGAACTTCGATGAGCGCATGGCGCAGATCGCGCCGTCGCTGAGCTATCACGTGAAGAACGT
GCTGACCAACGACGGCACGCTGATTCCGATCGATCTGACGTTCACGTCGATGGAATCGTTCGAGCCGGCG
GACGTCGTCAAGCGCATTCCCGAGCTGTCGACGCTGCTCGAGGCGCGCAACCGGCTGAAGGAGCTGCTGA
CCTACATGGACGGCAAGGCGGCAGCCGAGGACGTGATCCAGGAATTGTTGAAGAGCCCGCAGTGGGCGAA
CGAGGCCGACGCGGCGGAGCAATCCGGCGGCGCCGGCGAGGGTGGAGACCATCAACCGGAAGAGGGTGCG
AAATGA