SecReT6
Protein ID: 77358937
SecReT6 ID68
T6SS typei3
Gene symbol-
Locus tagBMAA0408
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]400807..402177 [+]
Producthypothetical protein
NoteTssG
UniProt IDQ4V2U3
KEGG IDbma:BMAA0408
PDB IDNA
Domain hit(s) vs Pfam DUF1305 [PF06996], Evalue: 4.80E-130, Aligned region: 41..403
Protein Sequence: 456 a.a.     [Download]
>gi|77358937|ref|YP_338348.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MPNAVRGAAADVAPSAAPSATPSATSQAAAARRDAWWRRLRAAPHGYDLFHALRWLDALSPEHAPSGYAS
RPRDEPVRFGQAPSLAFAAAMLADVRDDGPRPRVAIHGFGLFGPNGPLPSHLTEYAYERATQHDDPTFAA
FADLFHHRLILLFYRAWADAQPTVSLDRPARARFDRYVASLIGPCDALLADSPRGSRPDSSFASSSDSLP
DSLPDSLPDSPPDSSPDSPPDSRSDSPSDARLDPHPDSPRGAGALAPHAKYHQAGHLVRHTRNPEGLVQI
LRRYFGVRVRIVEHVPHWVMLDRAQRCAIRATRPTQPLGGAVLGRAVRDAQSRFRIVLGPLTLDEYRRFL
PGGVHARQLAQWVREYVGIEFDWDVQLELARGEVPTLALGSRHGLGRTAWLGERLDPGPARDLVLGYDER
MRASRARSGAADQAAAAGALIANLPEREPPCPISAE
 
Nucleotide Sequence: 1371 bp     [Download]
>gi|77358719|ref|NC_006349.2|:400807-402177 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGCCGAATGCAGTCCGGGGCGCGGCTGCGGATGTCGCGCCAAGCGCGGCGCCGAGCGCGACGCCGAGCG
CGACGTCGCAGGCCGCCGCCGCGCGCCGCGACGCATGGTGGCGCCGCCTGCGCGCCGCGCCGCACGGCTA
CGACCTGTTTCATGCGCTGCGTTGGCTCGATGCGCTGTCGCCCGAGCACGCGCCGTCCGGCTACGCGTCG
CGGCCGCGCGACGAGCCGGTGCGCTTCGGCCAGGCGCCGTCGCTCGCGTTCGCGGCCGCGATGCTCGCCG
ACGTGCGTGACGACGGCCCGCGCCCGCGCGTCGCGATTCACGGCTTCGGGCTGTTCGGGCCGAACGGGCC
GCTGCCGTCGCATCTGACCGAGTACGCATACGAGCGCGCGACGCAGCATGACGATCCGACCTTCGCCGCG
TTCGCCGACCTGTTTCATCATCGGCTGATCCTGCTGTTCTATCGCGCATGGGCCGATGCGCAGCCGACCG
TCAGCCTCGATCGGCCGGCGCGCGCGCGGTTCGACCGCTACGTGGCCAGCCTGATCGGGCCGTGCGACGC
GTTGCTTGCCGATTCACCGCGCGGCTCACGGCCCGATTCGTCCTTCGCTTCGTCGTCCGATTCACTGCCT
GATTCACTGCCTGATTCACTGCCTGATTCACCGCCTGATTCATCGCCTGATTCGCCGCCTGATTCGCGGT
CCGATTCGCCGTCCGATGCGCGCCTCGATCCGCATCCCGACTCGCCGCGCGGCGCTGGCGCGCTCGCGCC
GCACGCGAAGTATCACCAGGCCGGCCATCTGGTGCGGCACACGCGCAACCCGGAGGGGCTCGTGCAGATC
CTGCGGCGCTATTTCGGTGTGCGGGTACGCATCGTCGAGCACGTGCCGCACTGGGTGATGCTCGATCGCG
CGCAGCGCTGCGCGATCCGCGCGACGCGGCCGACGCAGCCGCTCGGCGGCGCCGTGCTCGGCCGTGCGGT
GCGCGACGCGCAGTCGCGCTTCCGGATCGTGCTCGGCCCGCTGACGCTCGACGAATACCGGCGGTTCCTG
CCGGGCGGCGTCCATGCGCGGCAGCTCGCGCAATGGGTGCGCGAATACGTCGGCATCGAATTCGACTGGG
ACGTGCAGCTCGAGCTCGCGCGCGGCGAAGTGCCGACGCTCGCGCTCGGTAGCCGTCACGGGCTCGGCCG
CACCGCATGGCTCGGCGAGCGGCTCGACCCCGGCCCCGCGCGCGACCTCGTGCTCGGCTACGACGAGCGC
ATGCGCGCTTCGCGCGCACGATCGGGCGCGGCCGATCAGGCGGCCGCCGCCGGTGCGTTGATCGCCAACC
TGCCTGAACGGGAACCGCCATGTCCGATATCGGCCGAGTGA