SecReT6
Protein ID: 77358939
SecReT6 ID68
T6SS typei3
Gene symbol-
Locus tagBMAA0407
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]398819..400690 [+]
Producthypothetical protein
NoteTssF
UniProt IDQ4V2U4
KEGG IDbma:BMAA0407
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 3.10E-218, Aligned region: 5..622
Protein Sequence: 623 a.a.     [Download]
>gi|77358939|ref|YP_338347.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MDTRLLDYYNRELAYLRELGGEFAQQFPKVAARLRMHESGPPDPYVERLLEGFSFLTARVQLKMDAEFPR
FTQALLDAVYPGYVAPLPSMAIVQFTPMMNEGSLAQGYRLPAGTALRARPAAAEQTACEFRTAHDLTLWP
LELADASVTGAPAYLPRSATAARRDVRGALRIRLKARGGAGLAQLPIDRLMFHLAGPERDALHLLELIAG
HTIGVVCHDAAQPPRWLHALGAHALAHQGFDADQALLPDEGRSFHGYRLLREYFAFPARFLFFSIEGLRP
ALARATGDTFELTLLLDRHDAALENSVDARHLALNCTPAVNLFARRADRIPVHPGAREHHVVVDRSRPLD
YEVYAVRRLAGEQRDDGQTRAFRPFHASFAGDGGNYGAYYTVRREPRLVSAQARANGTRTGYVGSETFVS
LVDSACAPYDESIRYLSVDTLCTNRDLVLLLPAGDANAFTLRVSAPVERIAMIRGPSRPRPPLADAQSAW
RLVSHLGLARHTLTDVDDEEGARVLRELLGLHADPADAAMRRQIDGVHRVAFAPVFRRLPAAGPLMFGRG
VQVDVTVDDHAFSGDSPYLLGAVLEQFFARHVSINSFAECVLSSAQRGRLAQWPARVGRRPAI
 
Nucleotide Sequence: 1872 bp     [Download]
>gi|77358719|ref|NC_006349.2|:398819-400690 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGGATACGCGCCTGCTCGACTACTACAACCGCGAGCTCGCGTATCTGCGCGAGTTGGGCGGCGAGTTCG
CGCAGCAGTTTCCGAAAGTGGCCGCGCGCCTGCGGATGCACGAATCGGGGCCGCCCGATCCGTACGTCGA
GCGGTTGCTCGAAGGCTTCAGCTTTCTCACCGCGCGCGTGCAACTGAAGATGGACGCGGAGTTTCCGCGC
TTCACGCAGGCGCTGCTCGACGCGGTGTATCCGGGTTACGTCGCGCCGCTTCCGTCGATGGCGATCGTGC
AGTTCACGCCGATGATGAACGAAGGCAGCCTCGCGCAGGGCTACCGGCTGCCGGCGGGCACCGCGCTGCG
CGCGCGGCCCGCCGCGGCCGAACAGACCGCGTGCGAGTTTCGCACCGCGCACGATCTGACGCTGTGGCCG
CTGGAGCTCGCGGACGCTTCGGTGACGGGCGCGCCCGCGTATCTGCCGCGTTCGGCGACGGCAGCGCGCC
GCGACGTGCGCGGCGCGCTGCGCATCCGGCTGAAGGCGCGCGGCGGCGCGGGCCTCGCGCAACTGCCGAT
CGATCGGCTGATGTTCCACCTGGCGGGCCCCGAGCGCGACGCGCTGCATCTGCTCGAACTGATCGCCGGG
CATACGATCGGCGTCGTCTGCCACGACGCGGCGCAGCCGCCGCGCTGGCTGCACGCGCTTGGCGCGCACG
CGCTCGCGCATCAGGGCTTCGACGCCGATCAGGCGCTGCTGCCCGACGAAGGCCGCAGCTTCCACGGTTA
CCGGCTGCTGCGCGAGTACTTCGCGTTTCCCGCGCGCTTCCTGTTCTTCAGCATCGAAGGATTGCGGCCC
GCGCTCGCGCGCGCGACGGGCGACACGTTCGAGCTGACGCTGCTGCTCGATCGGCACGACGCGGCGCTCG
AGAACAGCGTCGATGCGCGGCACCTCGCGTTGAACTGCACGCCGGCCGTCAACCTGTTCGCGCGGCGCGC
GGACCGCATTCCGGTCCATCCGGGCGCGCGCGAGCATCATGTCGTCGTCGATCGCAGCCGGCCGCTCGAC
TACGAGGTCTACGCGGTGCGGCGGCTCGCGGGCGAGCAGCGCGACGACGGGCAGACGCGCGCGTTCCGGC
CGTTCCATGCGTCGTTCGCGGGCGACGGCGGCAATTACGGCGCGTACTACACGGTGCGCCGCGAGCCGCG
CCTCGTGTCCGCGCAGGCGCGCGCGAACGGCACGCGCACCGGCTACGTCGGCAGCGAGACGTTCGTGTCG
CTCGTCGATAGCGCGTGCGCGCCGTATGACGAATCGATCCGCTATCTGTCCGTCGACACGCTGTGCACGA
ACCGCGATCTCGTCCTGCTGTTGCCGGCGGGCGACGCGAACGCGTTCACGCTGCGCGTGTCGGCGCCCGT
CGAGCGGATCGCCATGATCCGCGGGCCGTCGCGGCCGCGCCCGCCGCTCGCCGACGCGCAGAGCGCGTGG
CGGCTCGTGAGCCATCTCGGGCTCGCGCGCCACACGCTGACCGATGTCGACGACGAAGAAGGCGCGCGCG
TGCTGCGCGAATTGCTCGGCCTGCACGCGGACCCGGCCGATGCGGCGATGCGCCGGCAGATCGACGGTGT
GCATCGCGTCGCGTTCGCGCCGGTGTTTCGCCGGCTGCCCGCCGCCGGGCCGCTGATGTTCGGGCGCGGC
GTGCAGGTGGACGTGACCGTCGACGATCATGCGTTTTCCGGCGACAGCCCCTATTTGCTCGGTGCGGTGC
TCGAGCAGTTTTTCGCGCGGCACGTGTCGATCAACTCGTTCGCCGAATGCGTGCTGAGCAGCGCGCAGCG
CGGCAGGCTCGCGCAATGGCCGGCGCGCGTCGGCAGGCGGCCCGCGATATGA