SecReT6
Protein ID: 77358940
SecReT6 ID68
T6SS typei3
Gene symbol-
Locus tagBMAA0406
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]398266..398814 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ4V2U5
KEGG IDbma:BMAA0406
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 1.90E-22, Aligned region: 46..160
Protein Sequence: 182 a.a.     [Download]
>gi|77358940|ref|YP_338346.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MRAAGGGAGGVRAAHDRLQPALLDRLTDAERERRTEPPDAQAIGGERLRAAVLRDLAWLLNTRNGEDGFV
DWSAFAHAQASVLNYGMRPLVGKPMSGVERMSVEASIRDAIVRFEPRIAPDSVEVRSVLDAPGGAAGERR
HNVLMFEIKGTLWSIPHPVEFVLRSDLDLETGAMALHPAAGG
 
Nucleotide Sequence: 549 bp     [Download]
>gi|77358719|ref|NC_006349.2|:398266-398814 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
GTGCGAGCCGCGGGCGGCGGAGCGGGCGGCGTGCGCGCCGCGCATGACCGGCTGCAGCCGGCGCTGCTCG
ACCGGCTGACCGACGCCGAGCGCGAGCGGCGCACCGAGCCGCCCGACGCGCAGGCGATCGGCGGCGAGCG
CTTGCGCGCGGCGGTGCTGCGCGATCTGGCGTGGCTGCTCAACACGCGCAACGGCGAGGACGGCTTCGTC
GACTGGTCGGCGTTCGCGCACGCGCAGGCGTCGGTGCTCAACTACGGGATGCGGCCGCTCGTCGGCAAGC
CGATGTCGGGCGTCGAGCGGATGTCGGTCGAGGCGTCGATCCGCGATGCGATCGTGCGTTTCGAGCCGCG
TATCGCGCCCGACAGCGTCGAGGTGCGCAGCGTGCTCGACGCGCCGGGCGGCGCGGCGGGCGAGCGCCGG
CACAACGTGCTGATGTTCGAGATCAAGGGCACGCTGTGGTCGATTCCGCATCCGGTCGAGTTCGTGCTGC
GCTCGGACCTCGATCTGGAGACGGGCGCGATGGCGCTGCACCCGGCGGCGGGAGGCTGA