SecReT6
Protein ID: 77358942
SecReT6 ID68
T6SS typei3
Gene symbol-
Locus tagBMAA0404
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]396176..397684 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ4V2U7
KEGG IDbma:BMAA0404
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 3.10E-194, Aligned region: 69..495
Protein Sequence: 502 a.a.     [Download]
>gi|77358942|ref|YP_338344.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MNERAQTQADTRAAAQPVVARDEFAALLQKEFKPKTAEARESVERAVRTLAQQALEHTVGMTTDAYGSVK
QIIAEIDRKLSEQINLILHHQEFQTLEGAWRGLHYLVTNTETDELLKIKALPASRNELARTLKRYKGVAW
DQSPLFRKVYEEEYGQFGGEPFGCLVGDFHFNHSPPDVEMLGELSKIAAAAHAPFIAGASPELMQMDSWQ
ELANPRDLTKIFQNTEYAAWRSLRQSEDSRYVGLAMPRFLARLPYGARTNPVDEFDFEEDTGAASHDRYT
WANSAYAMAANINRSFKLYGWCSSIRGVESGGAVQGLPCHTFPTDDGGVDQKCPTEIAISDRREAELAKN
GFMPFVHRKNSDFAAFIGAQSLYQPAEYHDPDATANARLSGRLPYLFACCRFAHYLKCIVRDKIGSFRER
DDMERWLNDWIMNYVDGDPANSSQETKARKPLAAAQVVVEEIDDNPGYYASKFFLRPHYQLEGLTVSLRL
ISKLPSAKAAGE
 
Nucleotide Sequence: 1509 bp     [Download]
>gi|77358719|ref|NC_006349.2|:396176-397684 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAATGAACGTGCCCAAACCCAGGCCGACACGCGCGCCGCCGCCCAGCCCGTGGTCGCGCGCGACGAGT
TCGCCGCGCTGCTGCAAAAGGAGTTCAAGCCGAAGACGGCGGAGGCGCGCGAATCGGTCGAGCGCGCGGT
GCGCACGCTCGCGCAGCAGGCGCTCGAGCACACGGTCGGCATGACGACCGACGCTTACGGCAGCGTCAAG
CAGATCATCGCCGAGATCGACCGCAAGCTCTCCGAGCAGATCAACCTGATCCTGCATCATCAGGAGTTCC
AGACGCTCGAAGGCGCGTGGCGCGGCCTGCACTACCTCGTCACGAACACCGAGACCGACGAGCTGCTGAA
GATCAAGGCACTGCCCGCGTCGCGCAACGAGCTCGCGCGCACACTCAAGCGCTACAAGGGCGTCGCGTGG
GATCAGAGCCCGCTGTTTCGCAAGGTCTACGAAGAAGAGTACGGCCAGTTCGGCGGCGAGCCGTTCGGCT
GCCTCGTCGGCGATTTCCATTTCAACCACAGTCCGCCCGACGTCGAGATGCTCGGCGAGCTGTCGAAGAT
CGCGGCGGCCGCGCATGCGCCGTTCATCGCGGGCGCGTCGCCCGAGCTGATGCAGATGGATTCGTGGCAG
GAGCTCGCCAATCCGCGTGATCTGACGAAGATCTTCCAGAACACCGAATACGCCGCGTGGCGCAGCCTGC
GCCAGTCCGAGGATTCGCGCTACGTCGGGCTCGCGATGCCGCGCTTTCTCGCGCGGCTGCCGTACGGCGC
GCGCACGAATCCCGTCGACGAATTCGACTTCGAGGAGGATACCGGCGCCGCGAGCCACGACCGCTACACG
TGGGCGAATTCCGCGTACGCGATGGCGGCGAACATCAACCGCTCGTTCAAGCTGTACGGCTGGTGCTCGT
CGATCCGCGGCGTCGAATCGGGCGGCGCGGTGCAAGGGCTGCCGTGCCACACGTTCCCCACCGACGACGG
CGGCGTCGACCAGAAATGCCCGACCGAGATCGCGATCAGCGACCGCCGCGAGGCCGAGCTCGCGAAGAAC
GGCTTCATGCCGTTCGTACATCGAAAGAATTCGGATTTCGCGGCGTTCATCGGCGCGCAGTCGCTGTATC
AGCCCGCCGAGTATCACGATCCCGACGCGACCGCGAACGCGCGGCTCTCGGGCCGCCTGCCGTACCTGTT
CGCGTGCTGCCGCTTCGCGCATTACCTGAAGTGCATCGTGCGCGACAAGATCGGCTCGTTTCGCGAGCGC
GACGACATGGAGCGCTGGCTCAACGACTGGATCATGAACTACGTCGACGGCGATCCGGCGAACTCGTCGC
AGGAGACGAAGGCGCGCAAGCCGCTCGCGGCCGCGCAGGTCGTCGTCGAGGAGATCGACGACAACCCCGG
CTATTACGCGTCGAAATTCTTCCTGCGGCCGCATTACCAGCTGGAAGGGCTCACCGTGTCGCTGCGGCTC
ATCTCGAAGCTGCCGTCGGCGAAGGCGGCGGGCGAATGA