SecReT6
Protein ID: 77358952
SecReT6 ID70
T6SS typei1
Gene symbol-
Locus tagBMAA0731
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]742735..743400 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ4V2Q4
KEGG IDbma:BMAA0731
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 9.10E-44, Aligned region: 1..208
Protein Sequence: 221 a.a.     [Download]
>gi|77358952|ref|YP_338387.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MKLTDSMMPLVAYARQLAQSPRGDAAEVALRLDILIERARDHAACAGAPAADVDDALFAVCAWIDEALLN
SGWDDADRWTLRLLQKRYFDTSHAGVVFFERLGTLDGARASVLEVYLLCLRLGFRGRYGYDGGDGPLDAI
RQRALDALSAHAPPCAAGEPPFPAAYAHAGPHAAAAKARTRRRIARAGLSVGLPLAILLSLYLIYHVVIV
RMVDAVYPRLQ
 
Nucleotide Sequence: 666 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c743400-742735 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGAAGCTGACCGATTCGATGATGCCGCTCGTCGCGTATGCGCGGCAGCTCGCGCAATCGCCGCGCGGCG
ACGCCGCCGAAGTCGCGCTGCGGCTCGACATCCTGATCGAGCGCGCGCGCGACCACGCGGCGTGCGCGGG
CGCACCCGCGGCCGACGTCGACGACGCGCTGTTCGCGGTGTGCGCGTGGATCGACGAGGCGCTGCTGAAC
AGCGGCTGGGACGATGCCGATCGCTGGACGCTGCGGCTGCTGCAAAAGCGCTACTTCGATACGTCGCACG
CGGGCGTCGTGTTCTTCGAACGCCTCGGCACGCTCGACGGCGCGCGCGCGAGCGTGCTCGAGGTCTACCT
GCTGTGCCTGCGGCTCGGCTTTCGCGGCCGCTACGGCTACGACGGCGGCGACGGCCCGCTCGACGCGATC
CGCCAGCGCGCGCTCGATGCACTGTCGGCGCACGCGCCGCCGTGCGCCGCGGGCGAGCCGCCGTTTCCCG
CCGCCTATGCGCACGCCGGCCCGCACGCCGCCGCCGCGAAAGCGCGCACGCGCCGCCGGATCGCGCGCGC
GGGGCTGAGCGTCGGGCTGCCGCTCGCCATCCTGCTGTCGCTCTATCTGATCTATCACGTCGTCATCGTG
CGGATGGTCGACGCGGTGTACCCCAGGCTGCAATGA