SecReT6
Protein ID: 77358961
SecReT6 ID70
T6SS typei1
Gene symbol-
Locus tagBMAA0740
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]757693..759435 [-]
Producthypothetical protein
NoteTssF
UniProt IDQ4V2Q2
KEGG IDbma:BMAA0740
PDB IDNA
Domain hit(s) vs Pfam DUF879 [PF05947], Evalue: 4.30E-161, Aligned region: 7..580
Protein Sequence: 580 a.a.     [Download]
>gi|77358961|ref|YP_338389.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MATTTPNRYYEDELVRLRELAAEFARAHPLLAPMLGAPSGDPDVERLLEGVAFLTGLARQKLDEGLPELV
QALANLLFPHSLRPVPAATLIAFEPRGALRERAVIAAGTEIESVPVDGTACRFRTCGELDIEPIALAGCR
FVPPAHGGPALRLDFEMLGLDASEWDATRIRLFIGGERLHASRLFALLMQHVVAVEIAGGPPELPGPRCA
LGARALRPAGFDDALLPCPERAFPGFRLLHEYFAFAEKFLFVELGGLERWRAARAGAQFSVWLALDSAPD
WLPGIDRDSFRLNVAAALNLFAHEAVPIQHEHRATDYRLQPEGDTSGHYRIYSVDRVIGYRPGHAVDRHY
VPFGVAGDDANAASYRLIRRAALDGHGQDLHLALAYPPGEALATETLSIGLSCTNGALPARLKIGDVCRA
TDSSPERFTFANIAPVSPPLDPPLGEPLLWRTISHLALNFLSLGDADHLKRMLALHAFGERGDDARAQAD
RRRIDGIESVDVRAETRIIGERMLSGQRVALRCSAHAFGGAGELYLFGCVLERFLAEYAAINTYTRVEID
ASPDGVRFAWPPRMGAQCLL
 
Nucleotide Sequence: 1743 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c759435-757693 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGGCCACCACCACGCCCAATCGCTATTACGAGGACGAGCTCGTTCGCCTGCGCGAGCTCGCCGCCGAGT
TCGCCCGCGCGCACCCGCTGCTCGCGCCGATGCTCGGCGCGCCGTCGGGCGACCCGGACGTCGAGCGGCT
GCTCGAAGGCGTCGCGTTCCTGACGGGGCTCGCGCGGCAAAAGCTCGACGAAGGCCTGCCGGAGCTCGTG
CAGGCGCTCGCGAACCTGCTGTTTCCGCACTCGCTGCGCCCGGTGCCGGCGGCCACGCTGATCGCGTTCG
AGCCGCGCGGCGCGCTGCGCGAGCGCGCGGTGATCGCGGCCGGCACCGAGATCGAATCGGTGCCCGTCGA
CGGCACCGCCTGCCGGTTTCGCACGTGCGGCGAGCTCGACATCGAGCCGATCGCGCTCGCCGGCTGCCGG
TTCGTGCCGCCCGCGCACGGCGGGCCCGCGCTGCGGCTCGACTTCGAGATGCTCGGCCTCGACGCGAGCG
AATGGGACGCAACGCGCATTCGGCTGTTCATCGGCGGCGAGCGGCTGCACGCAAGCCGCCTGTTCGCGCT
GCTGATGCAGCACGTCGTAGCGGTCGAGATCGCGGGCGGCCCGCCCGAGCTGCCCGGCCCGCGCTGCGCG
CTCGGCGCCCGCGCGCTGCGCCCGGCGGGCTTCGACGACGCGCTGTTGCCCTGCCCCGAGCGGGCGTTCC
CCGGCTTCCGGCTGCTGCACGAATATTTCGCGTTCGCCGAGAAATTCCTGTTCGTCGAGCTGGGCGGCCT
CGAGCGCTGGCGCGCGGCGCGCGCTGGCGCGCAGTTCAGCGTATGGCTCGCGCTCGACAGCGCGCCCGAC
TGGCTGCCCGGCATCGATCGCGACAGCTTCCGGCTGAACGTCGCCGCCGCGCTGAACCTGTTCGCGCACG
AAGCGGTGCCGATCCAGCACGAGCATCGCGCGACCGATTACCGGCTGCAGCCCGAAGGCGACACGTCGGG
CCACTACCGGATCTACTCGGTCGACCGCGTGATCGGTTACCGCCCCGGCCACGCGGTCGACCGCCATTAC
GTGCCGTTCGGCGTCGCGGGCGACGACGCGAACGCCGCGAGCTACCGGCTGATTCGCCGCGCCGCGCTCG
ACGGCCACGGGCAGGATCTCCATCTGGCGCTCGCCTACCCGCCCGGCGAGGCGCTCGCCACGGAAACGCT
GTCGATCGGCCTGTCGTGCACGAACGGCGCGTTGCCCGCGCGCCTGAAGATCGGCGACGTGTGCCGCGCG
ACCGACAGCTCGCCCGAGCGCTTCACGTTCGCCAACATCGCGCCCGTGAGCCCGCCGCTCGATCCGCCGC
TCGGCGAACCGCTGCTGTGGCGCACCATCAGCCATCTCGCGCTGAACTTCCTGTCGCTCGGCGACGCCGA
TCATCTGAAGCGCATGCTCGCGCTCCACGCGTTCGGCGAACGCGGCGACGACGCGCGCGCGCAAGCCGAC
CGCCGCCGCATCGACGGCATCGAATCGGTCGACGTGCGGGCCGAGACGCGGATCATCGGCGAGCGGATGC
TGAGCGGCCAGCGCGTGGCGCTGCGCTGCAGCGCCCATGCGTTCGGCGGCGCGGGCGAGCTGTATCTGTT
CGGCTGCGTGCTCGAGCGCTTTCTGGCCGAATACGCGGCGATCAACACCTACACGCGCGTCGAGATCGAC
GCGTCGCCCGACGGCGTGCGCTTCGCGTGGCCGCCGCGAATGGGGGCGCAATGCCTGCTCTAG