SecReT6
Protein ID: 77358965
SecReT6 ID70
T6SS typei1
Gene symbol-
Locus tagBMAA0744
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]762178..762672 [-]
Producthypothetical protein
NoteTssB
UniProt IDQ4V2P8
KEGG IDbma:BMAA0744
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 5.30E-53, Aligned region: 5..160
Protein Sequence: 164 a.a.     [Download]
>gi|77358965|ref|YP_338393.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MTTNGSVAPKERVNIVYRPATGDAQAEVELPLKVLVLGEFSTAADKPPLEELSPVNVDKDDFNDVMRAQN
LQLALSVPNLLDDQAGEDDRLSVTLGFDSVHDFSPDAIVEKVPELKQLIALRDALKALKSPIGNIPGFRR
RIQEIVADKGARKQLLDELGLDEQ
 
Nucleotide Sequence: 495 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c762672-762178 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGACAACGAACGGATCCGTCGCACCCAAAGAGCGGGTCAACATCGTCTATCGCCCGGCGACGGGCGACG
CGCAGGCGGAGGTCGAGCTGCCGCTCAAGGTGCTCGTGCTCGGCGAGTTCTCGACGGCCGCCGACAAGCC
GCCGCTCGAGGAGCTCTCGCCCGTGAACGTCGACAAGGACGACTTCAACGACGTGATGAGGGCGCAGAAC
CTCCAGCTCGCGCTCAGCGTGCCGAACCTGCTGGACGATCAGGCCGGCGAGGACGACCGGCTGTCCGTCA
CGCTCGGCTTCGATTCGGTGCACGATTTCTCGCCCGACGCGATCGTCGAGAAAGTGCCCGAGCTCAAGCA
GCTGATCGCGCTGCGCGACGCGCTGAAAGCGCTGAAGAGCCCGATCGGCAACATTCCCGGCTTTCGCAGG
CGCATCCAGGAGATCGTCGCCGACAAGGGCGCGCGCAAGCAGTTGCTCGACGAACTCGGCCTCGACGAAC
AATGA