SecReT6
Protein ID: 77358966
SecReT6 ID70
T6SS typei1
Gene symbol-
Locus tagBMAA0743
StrainBurkholderia mallei ATCC 23344
Repliconchromosome II [GenBank: NC_006349] [Browse all T6SS(s) in this replicon]
Location [Strand]760655..762154 [-]
Producthypothetical protein
NoteTssC
UniProt IDQ4V2P9
KEGG IDbma:BMAA0743
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.20E-187, Aligned region: 72..497
Protein Sequence: 499 a.a.     [Download]
>gi|77358966|ref|YP_338392.1| unnamed protein product [Burkholderia mallei ATCC 23344]
MEGEHLQSPKHDDAPDATPPESPASLLDELIEAARVKRDEDAYPITRHGIQAFVAHLAKPKRPIETVSQA
TIDDMIAEIDRKLCRQIDAILHDPAFQQLESTWRSLKFLVDRTDFRENVKVQILDVGKTALFDDFEDSPD
ITKSGLYQKVYTAEYGQFGGQPIGAIVANYTFGPGAQDVKLLQYVASTSAMAHTPFIAAAGPAFFGIDSF
GKLPNVKDLASLFEGPQYAKWNAFRESEDARYVGLTLPRFLLRLPYGANTTPVKRFNYEERVDGGDAHFL
WGNAAFAFATRLTASFADYRWCANVIGPKGGGTVTDLPLYAYESMGEIQNKIPTDVLISERREFELAEQG
FIALTMRKNSDNAAFFSANSTQKPKFFGISKEGKEAELNYRLSTQLPYIFVVNRLAHYIKVIQRENIGSW
KERGDLEQELNQWIRQYVVDMDNPSQSVRSRRPLRQAQIVVSDVEGEPGWYRVDMKVRPHFKYMGAFFTL
SLVGKLEKR
 
Nucleotide Sequence: 1500 bp     [Download]
>gi|77358719|ref|NC_006349.2|:c762154-760655 Burkholderia mallei ATCC 23344 chromosome 2, complete sequence
ATGGAAGGCGAACACCTGCAATCCCCGAAGCACGACGACGCGCCGGACGCGACGCCGCCCGAGTCCCCCG
CCTCGCTGCTCGACGAGCTGATCGAGGCCGCGCGCGTGAAGCGCGACGAAGACGCATACCCGATCACGCG
CCACGGCATCCAGGCGTTCGTCGCGCATCTGGCGAAGCCCAAGCGCCCGATCGAGACCGTGAGCCAGGCG
ACGATCGACGACATGATCGCCGAGATCGACCGCAAGCTGTGCCGGCAGATCGACGCGATCCTCCATGACC
CGGCATTCCAGCAACTCGAATCGACGTGGCGCTCGCTGAAGTTTCTCGTCGATCGAACGGATTTCCGCGA
GAACGTGAAGGTTCAGATTCTCGACGTCGGCAAAACGGCGCTGTTCGACGACTTCGAGGATTCGCCCGAC
ATCACGAAATCCGGGCTGTACCAGAAGGTCTATACGGCCGAGTACGGCCAATTCGGCGGCCAGCCGATCG
GCGCGATCGTCGCGAACTACACGTTCGGGCCCGGCGCGCAGGACGTCAAGCTGCTGCAGTACGTCGCGAG
CACGTCGGCGATGGCGCATACGCCGTTCATCGCGGCGGCGGGCCCCGCGTTCTTCGGCATCGATTCGTTC
GGCAAGCTGCCGAACGTGAAGGATCTCGCCTCGCTGTTCGAGGGGCCGCAATACGCGAAATGGAATGCGT
TTCGCGAAAGCGAGGACGCGCGCTACGTCGGCCTCACGCTGCCGCGCTTCTTGCTGCGGCTGCCTTACGG
CGCGAACACGACGCCCGTCAAGCGCTTCAACTACGAGGAGCGCGTCGACGGCGGCGACGCGCATTTTCTG
TGGGGCAACGCGGCGTTCGCGTTCGCGACGCGCCTCACCGCGAGCTTCGCCGACTATCGCTGGTGCGCGA
ACGTGATCGGGCCGAAAGGCGGCGGAACGGTGACCGATCTGCCGCTCTACGCGTACGAATCGATGGGCGA
GATCCAGAACAAGATCCCGACCGACGTGCTGATTTCCGAGCGCCGCGAGTTCGAGCTCGCCGAACAGGGC
TTCATCGCGCTGACGATGCGCAAGAACAGCGACAACGCCGCCTTTTTCTCCGCGAACTCCACGCAGAAGC
CGAAGTTCTTCGGCATCAGCAAGGAAGGCAAGGAGGCCGAGCTCAACTATCGGCTCAGCACGCAACTGCC
GTACATCTTCGTCGTCAACCGGCTCGCCCATTACATCAAGGTGATCCAGCGGGAAAACATCGGCTCGTGG
AAGGAGCGCGGCGATCTCGAGCAGGAGCTCAACCAGTGGATCCGCCAGTACGTCGTCGACATGGACAACC
CGTCGCAGAGCGTGCGCAGCCGCCGCCCGCTGCGGCAGGCGCAGATCGTCGTGTCGGACGTCGAGGGCGA
ACCCGGCTGGTATCGCGTGGACATGAAGGTGCGGCCGCACTTCAAGTACATGGGCGCGTTCTTCACGCTG
TCGCTCGTCGGCAAGCTCGAAAAGCGCTAG