SecReT6
Protein ID: 77459623
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3401
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3877953..3879041 [-]
ProductImpA-like protein
NoteTssA
UniProt IDQ3KAR5
KEGG IDpfo:Pfl01_3401
PDB IDNA
Domain hit(s) vs Pfam ImpA-rel_N [PF06812], Evalue: 7.30E-20, Aligned region: 62..122
ImpA-rel_N [PF06812], Evalue: 7.30E-20, Aligned region: 216..233
ImpA-rel_N [PF06812], Evalue: 7.30E-20, Aligned region: 240..265
Protein Sequence: 362 a.a.     [Download]
>gi|77459623|ref|YP_349130.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSLPSTPLPDLIDQLLAPISDDAPCGADLRYEREYDQLRDLRREDDASLPTGVWQSTLKRANWPEVERLT
TTLLLERSKDLMLSAWLGEAWLHLQALDGLPGSLALITGLCERYPEHLHPQAGDGDQSWRAIPLEWLVRR
YSEVLLTRVPLFGANNSDFESYTLETWRRIQVQQVQANDSKGAKASAETARSEHKKLIEQVRATPMAFWL
RHQGNLLLSLQHLQRLDAWCDAYLGDQGPGLGPLQDTLQALLTLVQEFIAMHPQQPLSAPPPAPVAVSPV
EASVAATPEAAPVPREPASREEAYRQLLLIAEYLARTEPHSPVPYLIRRGVEWGNKPLSELLGELISADA
ESRRLWTLLGVL
 
Nucleotide Sequence: 1089 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c3879041-3877953 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
GTGAGCCTGCCCTCGACCCCGTTGCCGGACCTGATCGATCAGTTGCTTGCGCCCATCAGCGACGATGCGC
CCTGTGGTGCGGATCTGCGTTATGAGCGCGAGTACGACCAGTTGCGCGATCTGCGCCGCGAGGACGACGC
GAGTCTGCCCACGGGTGTCTGGCAGTCGACCCTGAAACGGGCCAACTGGCCGGAAGTCGAGCGGTTGACC
ACCACGCTATTGCTCGAGCGCAGCAAGGACCTGATGCTCAGTGCCTGGCTGGGCGAGGCCTGGCTGCATT
TGCAGGCACTCGATGGACTGCCGGGCAGTCTGGCGCTGATCACCGGTCTGTGTGAGCGCTATCCCGAACA
TTTGCACCCGCAGGCCGGCGACGGTGACCAGTCGTGGCGGGCGATTCCGCTGGAATGGCTGGTGCGTCGC
TACAGTGAAGTACTGCTGACCCGGGTGCCTTTATTTGGCGCCAACAACAGCGATTTTGAGAGTTATACCC
TCGAAACCTGGCGGCGGATTCAGGTGCAGCAGGTGCAGGCCAACGACTCCAAAGGCGCCAAGGCGTCGGC
CGAAACTGCGCGCAGCGAACACAAGAAGCTCATCGAGCAGGTGCGGGCCACGCCCATGGCGTTCTGGCTG
CGCCATCAAGGCAATCTGCTGCTGAGCCTGCAACACCTGCAGCGTCTGGATGCCTGGTGCGATGCGTATC
TGGGAGATCAGGGGCCGGGGCTCGGTCCGTTGCAGGACACCCTTCAAGCGTTGTTGACACTGGTTCAGGA
GTTCATCGCCATGCACCCACAACAACCACTGTCGGCACCGCCGCCTGCGCCGGTCGCAGTCTCACCGGTT
GAAGCGTCTGTCGCGGCCACGCCCGAAGCCGCGCCAGTGCCGCGCGAACCGGCCAGTCGAGAAGAGGCTT
ATCGGCAATTGCTGCTGATCGCCGAGTACCTGGCCCGCACCGAACCCCACAGCCCGGTGCCGTATCTGAT
CCGGCGCGGGGTGGAATGGGGCAACAAGCCGTTAAGCGAGCTGCTCGGCGAGCTGATTTCGGCAGACGCC
GAATCCCGGCGTCTGTGGACTTTGCTCGGCGTGCTTTAG