SecReT6
Protein ID: 77459625
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3403
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3882856..3883620 [-]
Producthypothetical protein
NoteTssL
UniProt IDQ3KAR3
KEGG IDpfo:Pfl01_3403
PDB IDNA
Domain hit(s) vs Pfam DUF2077 [PF09850], Evalue: 1.00E-45, Aligned region: 15..226
Protein Sequence: 254 a.a.     [Download]
>gi|77459625|ref|YP_349132.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSQGSAASLGLQDAPLSSAFRQTWQQWSQDWSQLPKDSEDEAALVETVVELSTQASQRLWRTAFARVGDS
ATEQVKALVYAFVALVDETLLFSPWPGQSAWQEKPLESRLYSSRQAGEQVPAAIQTLLDEQQPTTRDLAN
VYLQCLILGFHGRLRGEQGQVQREKWRRALFTFAWQDEADYAAVSQRLVQPSMATPLQLPVRTALPDGFR
LALGILAMILLLTGLGQFLWRDIRQELEPVLQAPDTLAAPEQDS
 
Nucleotide Sequence: 765 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c3883620-3882856 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGTCGCAAGGAAGTGCCGCAAGCCTCGGGTTGCAGGACGCTCCGCTGAGCAGTGCGTTCCGCCAGACGT
GGCAGCAGTGGTCGCAGGACTGGAGCCAGTTGCCCAAGGACAGCGAGGACGAAGCTGCGCTGGTCGAAAC
CGTGGTCGAGCTCTCGACCCAGGCTTCGCAACGGCTGTGGCGCACCGCGTTTGCCCGGGTCGGCGATTCG
GCGACTGAACAGGTCAAGGCGCTGGTGTATGCCTTTGTCGCACTGGTCGATGAGACCCTGCTGTTCAGCC
CGTGGCCAGGCCAAAGCGCCTGGCAGGAAAAGCCCTTGGAGTCGCGACTGTACTCCAGCCGTCAGGCCGG
CGAACAAGTGCCGGCGGCGATCCAGACCCTACTCGATGAACAGCAGCCCACCACCCGCGATCTGGCCAAC
GTGTATTTGCAGTGCCTGATCCTCGGTTTCCACGGACGCCTGCGCGGTGAGCAGGGCCAGGTGCAACGGG
AAAAATGGCGGCGGGCCCTGTTCACGTTTGCCTGGCAGGACGAGGCCGATTACGCCGCTGTCAGTCAGCG
ACTGGTACAGCCCTCGATGGCGACACCCTTGCAGTTGCCGGTACGCACGGCGTTGCCCGATGGCTTTCGT
CTGGCGCTGGGCATTCTGGCGATGATTCTGCTGCTGACCGGGCTCGGGCAGTTTCTGTGGCGTGACATCC
GCCAGGAACTGGAGCCGGTGTTGCAGGCGCCCGACACGCTGGCGGCGCCGGAGCAAGACTCATGA