SecReT6
Protein ID: 77459626
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3404
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3883639..3884970 [-]
Producthypothetical protein
NoteTssK
UniProt IDQ3KAR2
KEGG IDpfo:Pfl01_3404
PDB IDNA
Domain hit(s) vs Pfam DUF876 [PF05936], Evalue: 4.30E-67, Aligned region: 20..411
Protein Sequence: 443 a.a.     [Download]
>gi|77459626|ref|YP_349133.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MSLLPDAVCWHEGMQLLPQHFQLQGLRAEALGAHLAQACNPWFFGVSHMEFDPSAMSAGVVRVLSLQGTM
PDGLPVNLQVGVDPTLELDVAAAIDATDDATVTVYLAISPLWRAGQLLPLKGRLQSVVGEALPDLTSGEF
PESITVWRPNPRLCTQLNKADSICLPLLKIRKEGGGFLPLPYTPPTPVLLPESPLGRRVVGLCARAREKC
LFLGGRLRQAQQAGNQDDALEIRRQMTALWARLPEVEGALISRVAHPQSIYVQLLGLAGAWSALDPLAGV
PAFAPLDFLELQRGYDPLLDWLENTLELIRAGYRSIAFERGEQSFSIQLPDEQPSQRLVIGLRMPNGASE
QAAGEWLRGAIIASAPHIALLSRQRMSGLTHQAMSRGEQVAYSVGDDTRLFVVTAEGSWFDAQLPLMIAA
PATKLTSSPWQVVLFVAQNSERA
 
Nucleotide Sequence: 1332 bp     [Download]
>gi|255961261|ref|NC_007492.2|:c3884970-3883639 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGAGTCTGCTACCTGACGCGGTCTGCTGGCATGAAGGCATGCAATTGCTGCCCCAGCATTTTCAGTTAC
AGGGCCTGCGGGCCGAGGCGCTCGGCGCGCATCTGGCTCAGGCGTGCAATCCGTGGTTTTTCGGCGTCAG
CCACATGGAGTTCGATCCGTCGGCGATGAGCGCCGGCGTGGTGCGGGTGCTGTCGTTGCAAGGGACGATG
CCGGACGGTCTGCCGGTCAATCTGCAAGTCGGCGTCGACCCGACGCTGGAGCTGGACGTCGCTGCCGCGA
TCGACGCCACGGACGATGCGACGGTGACGGTCTATCTGGCGATCAGTCCGCTGTGGCGCGCCGGTCAGTT
GCTGCCGCTCAAGGGGCGTCTGCAATCGGTGGTCGGCGAGGCGTTACCGGATCTCACCAGCGGCGAATTT
CCTGAATCGATCACGGTGTGGCGTCCCAATCCACGGCTGTGTACGCAACTCAACAAAGCCGATTCAATCT
GCCTGCCGCTGCTGAAAATCCGCAAGGAGGGCGGCGGTTTCCTGCCGTTGCCGTACACGCCGCCGACACC
GGTCCTGCTGCCAGAATCCCCATTGGGTCGGCGGGTGGTCGGGCTCTGCGCGAGGGCGCGGGAGAAGTGC
CTGTTTCTCGGCGGACGATTGCGCCAGGCGCAGCAGGCCGGCAATCAGGATGACGCGCTGGAAATCCGTC
GGCAGATGACGGCGTTGTGGGCGCGCTTGCCGGAGGTGGAAGGGGCGCTGATCAGCCGTGTCGCTCATCC
GCAAAGCATTTATGTGCAATTGCTGGGACTCGCCGGTGCGTGGTCGGCGCTGGATCCGCTGGCGGGTGTG
CCGGCTTTTGCGCCACTGGATTTTCTCGAATTGCAGCGCGGTTACGATCCGCTGCTCGACTGGCTGGAAA
ACACCCTGGAACTGATCCGCGCCGGTTACCGCAGCATCGCGTTCGAGCGCGGTGAGCAGAGCTTTTCCAT
TCAGTTGCCGGACGAGCAACCGAGCCAGCGTCTGGTCATCGGCCTGCGCATGCCCAACGGTGCCAGCGAG
CAGGCGGCCGGCGAATGGCTGCGCGGCGCGATCATCGCTTCGGCGCCGCACATTGCCTTGCTCAGCCGTC
AACGGATGAGCGGTCTGACGCATCAGGCCATGAGCCGCGGCGAACAGGTGGCCTACAGCGTCGGCGACGA
CACCCGGCTGTTCGTGGTGACCGCCGAAGGCAGCTGGTTCGACGCGCAACTGCCGCTGATGATCGCCGCG
CCGGCCACCAAGCTGACCAGCAGCCCGTGGCAAGTGGTGTTGTTTGTCGCCCAGAACAGTGAACGTGCCT
GA