SecReT6
Protein ID: 77459628
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3406
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3885692..3886234 [+]
Producthypothetical protein
NoteTssB
UniProt IDQ3KAR0
KEGG IDpfo:Pfl01_3406
PDB IDNA
Domain hit(s) vs Pfam DUF770 [PF05591], Evalue: 4.90E-54, Aligned region: 9..161
Protein Sequence: 180 a.a.     [Download]
>gi|77459628|ref|YP_349135.1| hypothetical protein Pfl01_3406 [Pseudomonas fluorescens Pf0-1] [TssB]
MAESTQHKLDRVRPPRVQITYDVEIGNAIEKKELPLVVGILADLSGKPLEPLAKLTERRFTEIDRDNFND
VLASIAPRATLQVNNTLSGDDSKLNIELNFKHIDDFDPVKVVEQVTPLRRLFEARQRLRDLLTKLDGNDD
LDKLLRDVIANTEGLQEIKSARPDTAVPAADTEAPAEPQA
 
Nucleotide Sequence: 543 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3885692-3886234 Pseudomonas fluorescens Pf0-1, complete sequence [TssB]
ATGGCAGAAAGTACCCAGCACAAGCTCGACCGGGTTCGCCCGCCCCGCGTGCAAATCACCTATGACGTCG
AAATCGGCAACGCCATCGAGAAAAAGGAATTGCCGCTGGTGGTCGGCATCCTCGCCGACCTCTCGGGCAA
GCCGCTCGAACCATTGGCAAAACTGACCGAACGCCGTTTCACCGAAATCGACCGCGACAACTTCAACGAC
GTCCTCGCCTCCATCGCGCCCCGCGCCACGCTGCAAGTCAACAACACCCTCAGCGGCGACGACAGCAAGC
TCAACATCGAACTCAACTTCAAGCACATCGACGACTTCGACCCGGTCAAGGTGGTGGAGCAAGTCACGCC
GCTGCGGCGTCTGTTCGAAGCCCGCCAGCGCCTGCGCGACCTGCTGACCAAACTCGACGGCAATGACGAT
CTGGACAAGCTGCTGCGCGACGTCATCGCCAACACCGAAGGCTTGCAAGAGATCAAGTCGGCCCGCCCGG
ACACCGCTGTCCCGGCCGCTGATACCGAAGCTCCGGCCGAACCGCAAGCCTGA