SecReT6
Protein ID: 77459629
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3407
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3886264..3887748 [+]
Producthypothetical protein
NoteTssC
UniProt IDQ3KAQ9
KEGG IDpfo:Pfl01_3407
PDB IDNA
Domain hit(s) vs Pfam DUF877 [PF05943], Evalue: 1.10E-191, Aligned region: 67..489
Protein Sequence: 494 a.a.     [Download]
>gi|77459629|ref|YP_349136.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MPAAAQNQASENAAAETLSLLDRIIAEGRMAHDDSQQDYARDMLAEFATQVLDEGMAIDKDTVAMINDRI
SQIDELISAQLNEVLHHPDLQKLEASWRGLHMLVQNTETSTRLKLRLLNVTQKELQNDLEKAVEFDQSAL
FKKIYEEEYGTFGGHPFSLLVGDYTFGRHPQDIGLLEKLSNVAAAAHAPFIAAASPRLFDMNSFTELAVP
RDLSKVFESQELIKWRSFRESEDSRYVSLVLPHFLLRLPYGPDTSPVEGINYVEDTNGTDHSKYLWGNAA
WALSQRITEAFAKYGWCAAIRGAEGGGAVEGLPAHTFRTSSGDLSLKCPTEVAITDRREKELNDLGFIAL
CHKKNSDVAVFFGGQTTNKSKVYNTNEANANARISAMLPYVLAASRFAHYLKVIMRDKVGSFMTRDNVQT
YLNNWIADYVLINDNAPQEIKAQYPLREARVDVTEVAGKPGAYRATVFLRPHFQLEELTASIRLVATLPP
PVAA
 
Nucleotide Sequence: 1485 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3886264-3887748 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGCCCGCCGCCGCCCAGAATCAAGCCAGCGAAAATGCTGCCGCCGAGACTTTATCCCTGCTCGATCGAA
TCATCGCCGAGGGCCGCATGGCCCATGACGACAGTCAGCAGGATTACGCCCGCGACATGCTCGCGGAATT
CGCCACCCAGGTACTCGACGAAGGCATGGCCATCGACAAGGACACCGTGGCGATGATCAACGACCGCATC
AGCCAGATCGACGAACTGATCAGCGCCCAGCTCAACGAAGTGCTGCATCACCCGGACCTGCAAAAACTCG
AAGCGTCCTGGCGTGGCCTGCACATGCTGGTGCAGAACACCGAAACCAGCACCCGGCTGAAACTGCGCCT
GCTCAACGTGACCCAGAAAGAGCTGCAGAACGACCTGGAAAAAGCCGTCGAATTCGACCAGAGCGCGCTG
TTCAAAAAGATCTATGAAGAGGAATACGGCACCTTCGGTGGTCACCCGTTCAGCCTGCTGGTGGGCGACT
ACACCTTCGGCCGCCACCCGCAGGACATCGGCCTGCTGGAGAAACTGTCGAACGTCGCCGCCGCTGCCCA
CGCGCCGTTCATTGCCGCCGCCAGCCCGCGTCTGTTCGACATGAACAGCTTCACCGAACTGGCCGTGCCG
CGTGATCTGTCGAAAGTGTTCGAGAGCCAGGAACTGATCAAGTGGCGCTCGTTCCGTGAAAGCGAAGACT
CGCGTTACGTCTCGCTAGTGCTGCCGCACTTCCTGCTGCGTCTGCCTTACGGCCCGGACACTTCGCCAGT
GGAAGGCATCAACTACGTCGAAGACACCAACGGCACCGACCACAGCAAATACCTGTGGGGTAACGCCGCG
TGGGCGCTGTCGCAACGCATCACCGAAGCCTTTGCCAAGTACGGCTGGTGCGCGGCGATCCGTGGCGCTG
AAGGCGGCGGCGCGGTTGAAGGCCTGCCCGCGCACACCTTCCGCACCAGCTCCGGTGATCTGTCGCTCAA
ATGCCCGACCGAAGTGGCGATCACCGACCGCCGCGAGAAGGAACTCAACGACCTCGGCTTCATCGCCCTG
TGCCACAAGAAGAACAGCGACGTCGCGGTGTTCTTCGGCGGCCAGACCACCAACAAATCCAAGGTCTACA
ACACCAACGAGGCCAACGCCAACGCACGGATCTCGGCGATGTTGCCGTACGTGCTCGCGGCCTCGCGTTT
CGCCCATTACCTGAAGGTGATCATGCGCGACAAGGTCGGCAGCTTCATGACCCGCGACAACGTGCAGACC
TACCTCAACAACTGGATCGCCGACTACGTGCTGATCAACGACAACGCTCCGCAGGAGATCAAGGCGCAGT
ACCCGTTGCGTGAAGCGCGGGTGGATGTCACCGAAGTCGCCGGCAAGCCCGGTGCCTATCGCGCGACGGT
GTTCCTGCGGCCGCACTTCCAGCTCGAAGAGCTGACCGCGTCGATCCGCCTGGTCGCGACCCTGCCGCCA
CCGGTAGCCGCCTGA