SecReT6
Protein ID: 77459631
SecReT6 ID97
T6SS typei4a
Gene symbol-
Locus tagPfl01_3409
StrainPseudomonas fluorescens Pf0-1
Repliconchromosome [GenBank: NC_007492] [Browse all T6SS(s) in this replicon]
Location [Strand]3888338..3888781 [+]
Producthypothetical protein
NoteTssE
UniProt IDQ3KAQ7
KEGG IDpfo:Pfl01_3409
PDB IDNA
Domain hit(s) vs Pfam GPW_gp25 [PF04965], Evalue: 9.30E-22, Aligned region: 27..123
Protein Sequence: 147 a.a.     [Download]
>gi|77459631|ref|YP_349138.1| unnamed protein product [Pseudomonas fluorescens Pf0-1]
MAGTGLLPPLFERLASSEGDGAREFDRQDLLDSVHTELGRLFNTRRGPRTLTSPPSVIDYGIADWSALQQ
QRSDDRRRLARDIREAITHFEPRLLLGEVQVNPLPEHPQRLSIRLLGELRSGSQHWPVAFVIEPGNEGLE
VRHERLD
 
Nucleotide Sequence: 444 bp     [Download]
>gi|255961261|ref|NC_007492.2|:3888338-3888781 Pseudomonas fluorescens Pf0-1 chromosome, complete genome
ATGGCAGGCACCGGCTTACTTCCACCGCTGTTCGAACGCCTCGCCTCGAGCGAGGGCGACGGCGCGCGGG
AGTTCGATCGGCAGGATTTGCTCGACTCGGTGCACACCGAGCTCGGGCGCCTGTTCAACACCCGCCGTGG
CCCGCGCACCCTGACCTCCCCGCCCAGTGTCATCGACTACGGCATCGCCGACTGGAGCGCCCTGCAACAG
CAGCGCAGCGATGACCGTCGTCGGCTGGCGCGGGACATTCGCGAAGCCATCACCCATTTCGAACCGCGCC
TGCTGCTCGGCGAAGTTCAAGTCAATCCCCTGCCCGAGCACCCGCAGCGCCTGAGCATTCGCCTGCTCGG
CGAGTTGCGCAGCGGCTCGCAGCACTGGCCGGTGGCATTTGTCATCGAGCCCGGCAACGAAGGGCTGGAG
GTGCGCCATGAGCGACTCGATTGA